KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_013170Help
Entry
PCC21_013170      CDS       T02320                                 

Definition
(GenBank) formate dehydrogenase, nitrate-inducible, iron-sulfur subunit
  KO
K08349  formate dehydrogenase-N, beta subunit
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PCC21_013170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_10 Fer4_9 Fer4_21 Fer4_6 Fer4_2 Fer4 Fer4_16 Fer4_17 Fer4_4 Fer4_3 Fer4_8 Fer4_18 GP120 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AFR02720
LinkDB All DBs
Position
complement(1501484..1502392)
Genome map
AA seq 302 aa AA seqDB search
MSMQSQDIIKRSATNGFTPPPHVRDDKSEVAKLIDVTTCIGCKGCQVACSEWNDIRDEVG
HNFGVYDNPADLSAKSWTLMRFSEVEENDRLEWLIRKDGCMHCSDPGCLKACPSAGAVIQ
YANGIVDFQSEHCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCP
TGAIRFGTKEEMKHLAEERIADLKSRGYANAGLYDPQGVGGTHVMYVLHHADRPSLYNNL
PDDPQISTPVNLWKGILKPLSALGFVATFAGLMFHYIGVGPNTEEMDHDHEGEDKEGGDK
HE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgcaatcacaagatattattaaacgttcggccaccaacggctttacaccacct
ccgcatgtgcgtgatgacaaaagcgaagtggcaaaactgatcgatgtcaccacctgtatc
ggctgtaaaggctgtcaggtggcctgttcagagtggaacgatattcgtgacgaagtcggc
cataactttggcgtttatgataacccagcggatctgagcgccaaatcctggacgctgatg
cgcttttccgaagtggaagagaacgatcgtctggaatggttgatccgtaaagatggctgc
atgcactgtagcgatccgggctgtctgaaagcctgcccttccgctggtgcagttatccag
tatgccaacggtatcgtcgattttcagtcagaacactgtatcggctgcggctattgcatc
gccggctgcccgttcaatattccacgtctgaataaagaagataaccgcgtctataaatgt
acgctgtgcgtcgacagagtcagcgttggccaagagcctgcctgcgtgaaaacctgtccg
acgggtgccattcgtttcggtacgaaagaagagatgaagcatctggcagaagaacgcatc
gccgatctgaaaagccgtggttatgcgaacgcaggcctctacgatccacagggcgtgggc
ggtacgcacgtgatgtatgttctgcaccatgcagacaggccgtcgctttataacaaccta
ccggatgacccgcagatttctacgccggtcaacctgtggaagggcattctgaagccacta
tctgcgttagggtttgtcgccacgttcgccgggttaatgttccactacatcggtgtgggt
ccgaacacagaagaaatggatcatgaccacgaaggagaagataaagaagggggagacaaa
catgagtaa

DBGET integrated database retrieval system