KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_020250Help
Entry
PCC21_020250      CDS       T02320                                 

Definition
(GenBank) putative aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00010  Glycolysis / Gluconeogenesis
pcc01100  Metabolic pathways
pcc01110  Biosynthesis of secondary metabolites
pcc01120  Microbial metabolism in diverse environments
pcc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC21_020250
Enzymes [BR:pcc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PCC21_020250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFR03428
UniProt: J7KPZ8
LinkDB All DBs
Position
complement(2282886..2283755)
Genome map
AA seq 289 aa AA seqDB search
MHNTMFSLPVTKQISATLTQRQLDQLPIIVVDHPEVRAAVALQGAHLLSWQPTNEEPVLW
LSDNTPFTHHVAIRGGVPICFPWFGPFADPNHGFARLLPWEFTAHSEDEHGVQLTFTLQD
NEETRKSWPHAFTLIARFKLGKECGIELEAHGDYSITSALHTYFNIGDISNIRIAGLGES
FIDKVDQGKLATQQGDLVFTERTDRIYTQPQDTSVVHDAVLKRAIEVHHTHHSDVVSWNP
GAELSRTISDMTDEGYKTFVCVETARINQPFVASANAPARLATVIRIKK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcataacacaatgttctcactccccgtcacgaaacaaattagcgccaccctcacccag
cgtcagttggaccaattacccatcattgtcgttgatcaccctgaagttcgcgcggcagtc
gcattacaaggtgcgcacctgctcagctggcagccaacaaacgaagagccggtgctctgg
ctgagcgacaatacgccttttactcatcacgttgctattcgcggcggtgttccaatctgt
ttcccttggtttggccctttcgccgatcctaatcacggttttgcccgtctgctgccgtgg
gaatttaccgcccacagcgaagatgaacacggcgtacagctcacgttcacgctgcaggat
aatgaagaaacgcgcaagagctggccgcatgcgttcacgctcatcgcccgcttcaagctg
ggcaaggaatgtggcattgagttggaagcgcatggcgattacagcattaccagcgcgctg
cacacctatttcaatatcggcgatatcagcaatatccgcattgctggtctgggcgagtct
ttcattgataaggtggatcagggcaagctggcaacgcagcaaggcgatctggtctttacc
gagcgtacagaccgcatttatacccagccgcaggacaccagtgtggtacatgacgcagtg
ctgaaacgtgctatcgaagtgcaccatacgcaccatagcgatgtcgtgtcatggaacccc
ggtgctgaactctctcgtacgattagtgatatgaccgatgagggatataaaacgttcgtg
tgtgtggaaactgcgcgcattaatcaaccgtttgtcgcatccgcaaacgcaccagcgcgt
ctggcaacggttatccgcatcaagaaataa

DBGET integrated database retrieval system