KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_021430Help
Entry
PCC21_021430      CDS       T02320                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Brite
Enzymes [BR:pcc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PCC21_021430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AFR03546
LinkDB All DBs
Position
2417773..2418297
Genome map
AA seq 174 aa AA seqDB search
MKLKALILTGVFFSCSTFAASTTVTLNEALPTGTGGSIGEVSIAETPYGLLFTPNLKGLE
AGIHGFHVHENASCEPAEQDGKPVPALAAGGHLDPKKTGKHLGPYNDQGHLGDLPGLVVN
ADGTSTYPILAPRIKSLSEVKNHALMVHVGGDNYADTPAKLGGGGARMACGVIK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaggcacttatcctgacaggcgtgttcttttcctgttccaccttcgcggca
agcaccacggtgacgctgaatgaagcactgccaacgggcacgggtggaagtatcggtgag
gtatccattgcggaaacgccgtacggcctgcttttcactccgaatctgaagggattagaa
gcgggtattcatgggttccatgtacatgaaaatgccagctgtgaacctgccgagcaagac
ggcaaaccggttcccgctctggcggcaggtggccatctcgatccgaaaaaaaccggcaaa
caccttggcccgtataacgatcagggacatttgggcgacctgcccggtctggtcgtgaat
gcagatggcacgtcaacctatccgattttggctccccggataaaatcactctctgaggtg
aagaaccatgcgttgatggttcacgttggcggtgataactacgcggacacgccagcaaaa
ctgggcggtggcggagccagaatggcgtgtggtgtgattaagtaa

DBGET integrated database retrieval system