KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_037150Help
Entry
PCC21_037150      CDS       T02320                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Brite
KEGG Orthology (KO) [BR:pcc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PCC21_037150
Enzymes [BR:pcc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PCC21_037150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Glutaredoxin FAD_binding_3 NAD_binding_8 Thi4 DAO K_oxygenase Lycopene_cycl NAD_binding_7 AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: AFR05118
LinkDB All DBs
Position
complement(4226048..4227610)
Genome map
AA seq 520 aa AA seqDB search
MLDNTMKVQLKAYLEKLTKPVELIATLDDSAKSAEVRTLLAEIAELSDRVSFIEKNDLAV
RKPSFLITNPDSQSGPRFAGAPMGHEFTSLILALLQVGGHPSKEAKELLDQIRHLDGSFH
FETYYSLSCHNCPDVVQALNLMAVLNPNITHTAIDGGVFQDEIQSRNVMGVPTIFLNGEH
FSQGRMSLVEIVTKIDTGAGAKQVEKLNQRDVYDVLIIGSGPAGAAAAVYSARKGIRTGL
VGERFGGQVLDTVDIENYISVPKTEGAKLATALKSHVDDYDVDVIDAQSAEALIPGGEPG
KPHQVITVSGATLKARSVIIATGARWRNMNVPGEDQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQEKVRSLPNVDIILNAQTTEVKGD
GQKVTGLSYKDRLTDTVHDLALEGIFVQIGLLPNTHWLEGTVARNRIGEIEIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTRA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaatacgatgaaagtccagttgaaagcctatctggaaaaattaaccaaacct
gttgagttgattgcgactctggatgactctgctaaatctgctgaagtcagaaccctgctg
gctgagattgctgagctgtccgatcgggtaagttttattgaaaagaatgatctggcagta
cgtaagccttcattcctgattaccaatccagattcccaaagcggcccgcgttttgctggt
gcgccaatgggacacgaatttacctccctgattctggcgttattgcaggtgggcggccat
ccgtcgaaagaggcgaaagaattactcgatcaaatccgccatcttgacggttcgttccac
tttgaaacgtattactcgctgtcctgccacaactgcccggacgtggtgcaggcactgaat
ttaatggcggtcttgaatccgaatatcacccataccgcgattgatggcggcgtgttccag
gatgagatccaaagccgtaatgtcatgggcgttcccaccattttcctgaatggcgagcac
ttcagtcagggtcggatgagcctggttgagattgtgacgaaaatcgataccggcgcgggc
gctaaacaggttgagaagctgaatcagcgtgacgtctatgatgtgttaatcatcggtagc
ggcccggcgggcgcagcggcggcggtctattcggcgcgtaaaggcattcgcaccgggttg
gttggtgaacgctttggcggtcaggtactggataccgtcgatatcgaaaactacatttcc
gttccgaaaacggaaggggccaaactggcaaccgcgctgaagagccatgtggatgactac
gatgttgatgtgatcgacgcgcagagcgcagaagccctaattcctggtggcgaaccgggt
aaaccgcatcaggtgattaccgtatccggtgcgacgttgaaagcgcggagtgtgatcatt
gcgaccggcgcgcgctggagaaatatgaatgtacccggcgaagatcagtaccgtacgcgc
ggcgtaacatattgcccgcactgtgatggtccgttgtttaaaggcaaacacgtcgcggtg
attggcggcggaaactccggtgtcgaagcggctatcgatctggctggcgtggtgaaacat
gtcacgctgcttgagtttgcgccggaactgaaagcggattcggtattgcaggagaaagta
cgtagcttgccgaacgttgacatcatcctgaatgcgcaaaccacggaagtgaaaggcgat
ggtcagaaggtgacagggctgagctacaaagatcgtcttaccgatacggtgcatgattta
gcgctggaagggatcttcgtacagattggcctgctgcctaacacccactggctggaaggt
acggtagccagaaaccgcatcggtgaaattgagatcgatgccaagtgcgaaaccagcgtg
aaaggggtctttgctgccggcgactgtacgacggtgccgtacaagcagatcattatcgcg
acgggtgaaggcgcaaaagcgtccttgagcgcctttgactacctgatcagaacccgtgca
taa

DBGET integrated database retrieval system