KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_038760Help
Entry
PCC21_038760      CDS       T02320                                 

Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pcc01100  Metabolic pathways
pcc01110  Biosynthesis of secondary metabolites
pcc01130  Biosynthesis of antibiotics
pcc01230  Biosynthesis of amino acids
Module
pcc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pcc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PCC21_038760
Enzymes [BR:pcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     PCC21_038760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin dNK Cytidylate_kin2 AAA AAA_16 AAA_22 TsaE APS_kinase ABC_tran AAA_5 AAA_25 AAA_7 AAA_17 Ploopntkinase3 AAA_24 RNA_helicase AAA_28 AAA_PrkA His_biosynth AAA_29 RsgA_GTPase AAA_14 Mg_chelatase IstB_IS21
Motif
Other DBs
NCBI-ProteinID: AFR05279
LinkDB All DBs
Position
complement(4383609..4384130)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVGWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVETPPREVLEALAKERNPLYEEIADVTIRTDEQSAKVVANQIINMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
ggccgtcagttagctcagcaactcaatatggagtttttcgactccgatcaagaaattgag
cgacgcactggggctgatgtgggctgggtattcgatgtggaaggcgaagaaggcttccgc
gatcgtgaagagaaagtcattaatgaattgacggaaaagcaaggcatcgtactggcgaca
ggcggtggctcagtcaaatcacgtgagacgcgcaatcgtctttccgcgcgcggcgttgtc
gtttatttggaaacgacaatcgagaaacagcttgcccgcacgcagcgtgacaagaagcgt
ccgttacttcaggttgaaacccctccacgtgaagtattggaagcgttggcgaaagagcgg
aacccgctttatgaagaaatcgctgacgttaccattcggactgacgagcaaagtgccaag
gtcgttgctaaccagattatcaatatgctggaaagtaactaa

DBGET integrated database retrieval system