KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_038820Help
Entry
PCC21_038820      CDS       T02320                                 

Definition
(GenBank) 1A family penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00550  Peptidoglycan biosynthesis
pcc01100  Metabolic pathways
pcc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pcc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PCC21_038820
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PCC21_038820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pcc01003]
    PCC21_038820
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pcc01011]
    PCC21_038820
Enzymes [BR:pcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     PCC21_038820
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PCC21_038820
Glycosyltransferases [BR:pcc01003]
 Polysaccharide
  Bacterial polysaccharide
   PCC21_038820
Peptidoglycan biosynthesis and degradation proteins [BR:pcc01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   PCC21_038820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase DUF3502
Motif
Other DBs
NCBI-ProteinID: AFR05285
LinkDB All DBs
Position
4388414..4390897
Genome map
AA seq 827 aa AA seqDB search
MYRYIEPQLPDVATLKDVRLQTPMQVYSADGELIAQFGEKRRIPLKLDQVPPELVHAFIA
TEDSRFYDHHGVDPVGIIRAASIALTSGHASQGASTITQQLARNFFLSPERTLIRKIKEV
FLAIRIEQLLTKDEILELYLNKIYLGYRAYGVGAAAQVYFGRPVDQLTLSEMAMIAGLPK
APSTFNPLYSYDRAVARRNVVLARMKDENYITQSQYDAARNEKLVANYHAPDISFSAPYV
AEMARQEMVKRYGEDAYNDGYKVYTTVTKKLQTAAQDALRNNILAYDMRHGYRGPSKVLW
KVGEGVWDQAKMIAALKALPVYGPLYPAIVTSTTADNAIAILFDGSNIALPMAGMRWARA
YRSDTQQGPTPKRVTDVVQAGQQVWVRKVNDDWWLAQVPDVNSAIVSLNPKNGAIEALVG
GFDFNQSKFNRATQALRQIGSNIKPFLYTAAMDKGLTLATILNDVPITRWDAGAGSDWRP
KNSPATYDGPIRLRQGLGQSKNVVMVRAMRAMGVDYAADYLQRFGFPAQNIVHTESLALG
AASFTPLQVVRGYAVMANGGYLVDPYLISKIENEVSGTVFTATPKVVCDTCNLPLVYGET
PRSPVLATTNVEDVATSNEAPPVGLPQPELEPVTPEAAQQSAAQPYAPHVINTPLAFLIK
DALNSNVFGEPGWMGTGWRAGRDLKRRDIGGKTGTTNSSKDAWFSGYGPNLVTSVWIGFD
DHRRDLGASSASGVIKDQISGYEGGAKSAQPAWDDFMKAALDGVPEQPLTPPPGIVSVVI
DRSSGKLSNGGGNSRSEYFIDGTQPKEYEVHEVGTTLMDNGQSEELF
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
ttgtaccgttatatcgaaccccaactgcccgatgtcgccacgctgaaagacgttcggctg
caaacgcctatgcaggtttacagcgccgatggcgaactgatcgctcagtttggtgaaaaa
cgccgtatcccactcaagctggatcaggttccccctgagttggtacacgcttttatcgcg
accgaagacagccgcttctatgatcaccacggtgtcgatcccgtcgggatcatccgcgcc
gcgtctatcgcgctcacatcgggtcacgcctctcaaggggcgagtaccattacgcaacag
cttgccaggaacttcttcctgagcccggaacgcaccctgattcgtaagatcaaggaagtg
tttctggctatccgtattgagcagttgctgaccaaggatgaaatccttgagctttatctg
aacaagatttacctcggctatcgcgcttatggcgttggcgcagcggcacaggtttacttt
ggccgccctgttgaccagttgacgctgagcgaaatggcgatgatcgccggtctgccgaaa
gcgccatcgacgttcaacccgctctattcctacgaccgtgccgttgcccgtcgcaacgtc
gtccttgcacgtatgaaggatgaaaactacatcacccagtcgcaatacgatgcggcacgt
aacgaaaaactggtcgcgaattatcacgcaccggatatttcgttctccgccccgtatgtc
gcagaaatggcacgacaggagatggtcaaacgctacggcgaagatgcttataacgatggt
tataaggtctacacgacggtcaccaaaaaattgcaaaccgccgcacaggatgcgctgcgt
aataacatcctcgcctatgacatgcgccacggttaccgcggcccgagcaaagtgctctgg
aaggtaggcgaaggcgtctgggatcaggcgaagatgattgccgccctgaaagcgttgccg
gtctacggcccgctctatccggccatcgtcaccagcactacggctgacaacgcgattgcg
atcctgtttgacggcagcaacattgccctgccgatggcgggcatgcgctgggcacgtgca
taccgttccgatacgcagcaagggccaacaccgaagcgcgtcacggacgtggtacaggca
ggccagcaggtctgggtgcgtaaagtgaacgatgactggtggctggcacaggtgccggac
gtcaactctgccatcgtctcgcttaacccgaaaaacggggcgatagaagcactggttggc
ggttttgactttaaccaaagcaaattcaaccgtgcgacgcaggcactgcgtcagattggt
tccaacatcaaaccgttcctgtataccgctgcgatggacaaaggtttaacgctggcaacg
attctgaacgacgtaccgatcacccgttgggatgccggtgcaggatctgactggcggccg
aaaaactcaccggcaacctacgatggcccgatccgtttgcgtcaggggctgggtcaatcc
aaaaacgtagtgatggtacgtgccatgcgtgcgatgggcgtagactatgccgcggattac
ctgcaacgcttcggtttcccggcgcagaatatcgtccataccgaatcgctggcgctgggc
gcggcctcgtttacgccgctacaggtcgtacgtggttatgccgtcatggcaaacggcggc
tatctggtcgacccttatctgattagcaagatagagaacgaagtgagtgggacggtcttt
accgcgacgccgaaagtggtctgtgatacctgtaacctaccgctagtttacggtgaaacg
ccacgttctccggtgttggcgaccactaacgttgaagatgttgccacgtcaaacgaagcg
ccgccggtaggcctgccgcagccagaactggaacctgtcacgccagaagccgcacagcaa
agtgctgcacagccttatgcaccgcacgtgatcaacacgccgttggcgttcctgattaaa
gacgcgctgaacagcaacgtctttggcgaaccgggttggatgggaacgggctggcgtgca
ggccgtgatttgaaacgtcgtgatatcggcggtaaaaccggtaccacgaacagttccaaa
gacgcctggttctccggctatggcccgaatctggtgacttcagtctggattggcttcgac
gatcaccgtcgcgatctgggtgccagcagcgcatctggcgtcatcaaagatcagatctcc
ggttatgaaggcggtgcgaaatcagcacagcctgcgtgggatgatttcatgaaagccgcg
ctggatggcgtaccggagcaaccgctgacgccgccgcctggcatcgtcagtgtggtcatt
gaccgtagcagcggcaagctgtccaacggtggtgggaatagccgttccgaatacttcatt
gatggaacgcagccgaaagaatacgaagtgcatgaagtcggcaccacgctgatggataac
ggacaaagcgaagaattattctag

DBGET integrated database retrieval system