KEGG   Mixta calida: C2E16_10000Help
Entry
C2E16_10000       CDS       T05419                                 

Definition
(GenBank) superoxide dismutase [Cu-Zn] SodC2
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pcd  Mixta calida
Brite
Enzymes [BR:pcd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C2E16_10000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AUY25201
LinkDB All DBs
Position
2108579..2109100
Genome map
AA seq 173 aa AA seqDB search
MKHYGLAALTLLIAGYAQAASQEVTLHNLTKEGIGESVGTVKIDETAYGLTFTPALSHLP
AGIHGFHVHANGSCEPAVTDGKTVPGGAAGGHFDPQNSGKHLGPWAEGHLGDLPALYVTQ
DGRADYPVLAPRLKKISEISGRALMVHMGGDNHSDHPKPLGGGGDRYACGVIK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaacactacggtttagcggcgctgacgctgctgatagctggctatgcgcaggcggcg
agccaggaggtcacgttacataacctgaccaaagaaggcatcggcgaatcggtgggaacg
gtcaaaatcgatgaaaccgcgtatgggctgacctttacgccagcgctctcccatctgccg
gcgggcattcatggcttccatgtccatgcgaacggcagctgcgaacctgctgtcaccgac
ggaaaaaccgtaccgggcggcgcggcgggcgggcacttcgatccgcaaaacagcggtaag
catcttggcccctgggctgaaggacacttaggcgatctgccggcgctctacgtcacacag
gatggccgtgccgactatcccgttctggcgccgcgtttgaaaaaaatcagtgagatttct
ggccgggcgctgatggtgcatatgggcggcgataatcacagcgaccatcccaaaccgttg
ggcggcggcggcgatcgttacgcctgtggtgtgattaaatag

DBGET integrated database retrieval system