KEGG   Mixta calida: C2E16_15215Help
Entry
C2E16_15215       CDS       T05419                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
pcd  Mixta calida
Pathway
pcd00030  Pentose phosphate pathway
pcd01100  Metabolic pathways
pcd01110  Biosynthesis of secondary metabolites
pcd01120  Microbial metabolism in diverse environments
pcd01130  Biosynthesis of antibiotics
pcd01200  Carbon metabolism
pcd01230  Biosynthesis of amino acids
Module
pcd_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pcd_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pcd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C2E16_15215 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    C2E16_15215 (tkt)
Enzymes [BR:pcd01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     C2E16_15215 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C DXP_synthase_N E1_dh Alba
Motif
Other DBs
NCBI-ProteinID: AUY26118
LinkDB All DBs
Position
3194033..3196033
Genome map
AA seq 666 aa AA seqDB search
MSSRRELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDFLKHNPTNPAWADRDRF
ILSNGHGSMLLYSLLHLSGYDLPIEELKNFRQLHSKTPGHPEIGYTPGVETTTGPLGQGL
ANAVGLAIAERTLAAQFNRPDHEIIDHNTWVFMGDGCLMEGISHEVCSLAGTLGLGKLIG
FYDHNGISIDGETEGWFTDDTAKRFEAYNWHVVGEIDGHDPEAIAAAIKEAQSVTDKPSL
IICRTIIGFGSPNKAGKEEAHGAPLGDDEIALTRKQLGWNYGPFEIPQEIYQQWDAKQAG
QEREKAWNEKFAAYKAAYPELAAEYTRRMTGGMPENWQQETQKFIEQLQANANKIASRKA
SQNALEAYGKLLPEFLGGSADLAPSNLTIWSGSKSIKDDPAGNYIHYGVREFGMTAIANG
IAHHGGFVPYTATFLMFVEYARNAARMAALMKARQIMVYTHDSIGLGEDGPTHQPVEQLA
SLRLTPNMSTWRPCDQVETAVAWKHAIERHNGPTALILSRQNLMQPERTPQQLADISRGG
YILRDSEGAPEVILIATGSEVEITLGAAEKLTRAGHKVRVVSMPSTDLFDKQDAAYRESV
LPSTVTARVAVEAGIADYWYKYVGLNGAIVGMTTFGESAPADKLFAEFGFTVENIVSHAE
ALLKPH
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcacgtagagaactggcgaatgcgattcgtgcgctaagcatggacgcggtgcaa
aaagcaaaatcgggtcatccgggcgcgccgatgggcatggcggacatcgctgaagtgctg
tggcgtgatttcctcaagcacaatccgaccaacccggcctgggccgatcgcgaccgtttt
attctctctaacggccatggttcaatgctgctctatagcctgctgcacctgtccggctac
gatctgccgattgaagaactgaaaaacttccgtcagctgcactcgaaaacgccgggacac
ccggagatcggctataccccaggcgtggaaaccaccaccggtccgctgggccagggcctg
gcgaatgccgtcggcctggcgatcgccgagcgcacgctggcggcgcagttcaaccgccct
gaccacgagattatcgatcacaatacctgggtctttatgggcgacggctgcctgatggaa
ggcatctcgcatgaagtttgctcgctggccggcacgctgggcctcggtaagctgatcggc
ttctacgatcacaacggcatctccatcgacggcgaaaccgaaggctggttcaccgacgat
accgcgaagcgctttgaagcctataactggcatgtggtaggcgaaatcgacggccacgac
ccggaagcgatcgccgccgcgatcaaagaagcgcagagcgttaccgacaaaccgtcgctg
attatctgccgcaccatcatcggcttcggctcgccgaacaaggcgggtaaagaagaagcg
cacggcgcgccgctgggcgatgatgaaatcgcgctgacgcgcaaacagctgggctggaac
tacggtccgttcgaaatcccgcaggaaatttatcagcagtgggatgcgaaacaggcgggc
caggaacgggaaaaagcctggaatgaaaaattcgctgcctataaagccgcttacccggag
ctggctgcggaatatacgcgccgcatgaccggcggcatgccggaaaactggcagcaggag
acccagaaatttatcgaacaattgcaggcgaacgccaacaagatcgccagccgcaaagcg
tcgcagaatgcgctggaagcgtacggcaagctgctgccggagttccttggcggctccgcc
gacctggcgccgagcaacctgaccatctggtctggttctaaatcgattaaagacgatccg
gcaggcaactatattcactacggcgtacgcgaattcggcatgaccgctatcgccaacggc
atcgcgcatcacggcggctttgtgccttacaccgccaccttcctgatgtttgtggaatat
gcgcgcaacgccgcgcgcatggcggcgctgatgaaagcgcgtcagattatggtctatacc
catgactctatcggtctgggcgaagacggcccgacgcaccagccggttgagcagctcgcc
agcctgcgtctgacgccgaacatgagcacatggcgtccgtgtgatcaggttgaaaccgcg
gtggcgtggaagcatgccattgagcgtcataacggcccgaccgcgctgatcctgtcgcgt
cagaacctgatgcagcctgaacgcacgccgcagcagctggctgatatttcacgcggcggc
tatatcctgcgcgacagcgaaggcgcgccggaagtgatcctgatcgctaccggttccgaa
gtcgaaatcacgctgggcgcggcggagaagctgacgcgcgcgggccataaagtgcgcgtg
gtgtcgatgccgtctaccgacctgtttgataagcaggatgcggcttaccgtgaatcggtg
ctgccttctaccgtcaccgcgcgcgttgcggtggaagcgggcatcgctgactactggtat
aagtatgtcggcctgaacggcgcgatcgtcggcatgaccaccttcggtgaatcagcgccg
gcggacaagctgttcgccgaattcggctttaccgttgagaatatcgtcagccatgcggaa
gcgctgctgaagccgcactga

DBGET integrated database retrieval system