KEGG   Mixta calida: C2E16_15255Help
Entry
C2E16_15255       CDS       T05419                                 

Definition
(GenBank) D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
pcd  Mixta calida
Brite
KEGG Orthology (KO) [BR:pcd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pcd01002]
    C2E16_15255
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pcd01011]
    C2E16_15255
Enzymes [BR:pcd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C2E16_15255
   3.4.21  Serine endopeptidases
    3.4.21.-  
     C2E16_15255
Peptidases and inhibitors [BR:pcd01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   C2E16_15255
Peptidoglycan biosynthesis and degradation proteins [BR:pcd01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   C2E16_15255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AUY26124
LinkDB All DBs
Position
3200291..3201487
Genome map
AA seq 398 aa AA seqDB search
MKTRFYLLAALFATLPLRSQAATTPSPDPLLASQIVDRYAEHIFYGSAATGMALVAIDGN
QRVFASFGETRPGNQTRPQKDSLIRIASLSKLMTSEVMLKMAEQGRIQLEDPLAKYAPPG
MRVPDYAGQPMRLIHLSTHTSGLPREQPGGKAGRPVFVWPTKSDRWSWLQQARLTTPPGV
RAAYSNLAYDLLADALSRAAGTPYPALFRQLITRPLGMKDTTFTPSPEQCGRLMVPARGA
SPCSNTLAAIGSGGVYSTPEDMGRWMQQFLNSDINVRTPQIDRLQTLIYQRSQLTKVEGM
DVPGKAEALGMGWVYIAPADGHPGIIQKTGGGGGFITYMAMVPQHNVGVFVVVTRTNLTR
FRAMSDGVNDLLSELVGNKTGSPMMVQAIGQGGESASR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaactcgtttttatctgctggccgctctcttcgctacgctgccgctacgtagccag
gccgcgacgaccccgtcgcccgatcctctgttggcttcacaaatcgtggatcgctatgcc
gaacatatcttttacggcagcgccgctaccggtatggcgctggtagcgatagacggcaac
cagcgcgttttcgccagcttcggcgaaacccgtcccggcaatcagacacgcccgcagaaa
gattccctgattcgcatcgcctcgctcagtaaactgatgaccagcgaagtgatgctgaaa
atggccgaacaggggcgcattcagctggaagatccgctggcgaaatacgcgccgccgggc
atgcgcgtgcccgattatgccggtcaaccgatgcgcctgatccatctttcgacccatacc
agcggcctgccgcgcgaacagcccggcggtaaagcgggccgtccggttttcgtctggccg
actaaaagcgatcgctggagctggctgcaacaggcgcggctgacgacgccgcccggcgta
cgcgccgcctactcgaacctggcttatgatttgctggcggacgcgttgtcacgcgcggcg
ggcacgccttatcccgcgctgtttcgtcagctgattacgcgtccgctggggatgaaagac
accactttcaccccttcgccggagcagtgcggacggctaatggtgccggcgcgcggcgcc
agcccttgcagcaatacgctggccgccatcggcagcggcggcgtctattcaacgccggaa
gatatgggccgctggatgcagcagttcctgaattcggacattaacgtgcgcacgccgcag
atcgatcgtctgcaaacgctgatctatcagcgtagccagctgacgaaggtggaaggcatg
gatgtgcccggcaaggcggaagcgctgggtatgggctgggtctatatcgcgccggccgac
ggtcatccgggcattattcagaaaaccggcggcggcggcggctttatcacctatatggcg
atggtgccgcagcataacgtcggcgtgttcgtggtggtgacgcgtaccaatctgacgcgc
ttccgcgccatgagcgacggggttaacgatctgctgagcgagctggtcggcaacaaaacg
ggatcgccgatgatggtgcaggcgattggtcagggcggcgagtccgcttcccgctaa

DBGET integrated database retrieval system