KEGG   Pediococcus claussenii: PECL_153Help
Entry
PECL_153          CDS       T01713                                 

Definition
(GenBank) aspartate kinase domain protein
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
pce  Pediococcus claussenii
Pathway
pce00260  Glycine, serine and threonine metabolism
pce00261  Monobactam biosynthesis
pce00270  Cysteine and methionine metabolism
pce00300  Lysine biosynthesis
pce01100  Metabolic pathways
pce01110  Biosynthesis of secondary metabolites
pce01120  Microbial metabolism in diverse environments
pce01130  Biosynthesis of antibiotics
pce01210  2-Oxocarboxylic acid metabolism
pce01230  Biosynthesis of amino acids
Module
pce_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PECL_153
   00270 Cysteine and methionine metabolism
    PECL_153
   00300 Lysine biosynthesis
    PECL_153
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    PECL_153
Enzymes [BR:pce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     PECL_153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT_7 ACT
Motif
Other DBs
NCBI-ProteinID: AEV94477
UniProt: G8PEU7
LinkDB All DBs
Position
156084..157484
Genome map
AA seq 466 aa AA seqDB search
MKESSGMKVVKFGGSSLADAEHYQEVIAILNADHERRIVVVSAPGKRSEKDTKVTDLLIK
YATGTFMEARKALNSVIERYRAIANDFEVDEEAFRPIKQYLVDLPDFEYSSPEAQLARFK
AAGERLNAELLAVVLSKVGLTSRFIDPSELGIIVDGDYNNAVVNRGTYQNIAKKRDQLLE
TRDLLVVPGFYGYNKNNEVATFSRGGSDITGAILANGFAAEYYENFTDVDSIYSANPKVI
KNPHPIDEMTYREMRELSYAGFSVFHDEAIIPAIEGRVPIVVKNTNHPEAVGTSIVPEDE
FNAKGPVTGVASSKRFAALYLHRYLLNREVGFTLKLLQILYKYNISYEHMPSGIDDLTVI
FDRNQIDYTILPSLLTDIHDELQTDQLEWIDDYAIIMVVGEGMRNKVGTVDRIVSALAQN
KIGVQMINQGASRISIMLGVRQSQVDDAVQYIYEEFFKKDGVESND
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagtctagcggtatgaaagttgtaaagtttggtggaagttcgttagcagatgcg
gaacactatcaggaggttattgctattttaaatgctgatcatgaacgacgtattgttgtg
gtgtcagctcctggtaagcgttctgaaaaagatactaaagtaaccgatttgttgattaaa
tatgcaacaggaacatttatggaggcaagaaaagccctaaatagtgtgatcgaacgatat
cgagctatcgctaatgattttgaggtagatgaagaagcttttcggcctattaaacaatat
ttagttgatttgccagattttgaatattcttcaccggaagcccaattagctcgttttaag
gctgcgggagaacgtctgaatgcagaactactagctgtagtgcttagcaaggttgggtta
acatctaggttcattgatccaagtgagttaggaattattgttgatggtgattacaataat
gcagtggttaataggggaacctaccaaaatattgctaagaaacgcgatcagttgctagaa
acaagggatttgttagttgttcctggattctatggctacaacaagaataatgaagtagca
actttttcaaggggtggttcagacattaccggtgcaattttagctaatggatttgcagca
gagtattacgagaattttactgatgtagattcaatatattccgcgaatcctaaggtaatt
aaaaatcctcatccaattgatgaaatgacttatcgtgaaatgcgggaactttcgtacgca
ggcttctcagtatttcatgatgaagcaatcattccggcaattgagggccgtgtgcccatc
gttgtgaagaatactaatcatccagaagcggttggaacgagtattgttccagaggatgaa
tttaatgctaagggccctgtgacaggagttgcgagttccaagcgattcgcagcactatat
ttacatcgatatttattaaaccgtgaagttggatttacgctaaaattgcttcaaatacta
tataaatacaatattagttatgaacatatgccttcaggaattgatgatctaacggtgata
tttgatcgaaaccaaattgattatacaattttgccaagtttattaactgatattcatgat
gaattacagacggatcaacttgaatggattgatgactacgcaattattatggtggtcgga
gaagggatgcggaataaggttggaacggttgaccgtattgtttccgcacttgcacaaaat
aaaattggggttcaaatgattaatcagggagcatcccgaatttcaataatgctaggcgta
cgtcaatcacaggttgatgacgcagttcaatatatatatgaagaattctttaaaaaagac
ggggtagaaagcaatgactaa

DBGET integrated database retrieval system