KEGG   Polistes canadensis: 106783676Help
Entry
106783676         CDS       T05611                                 

Definition
(RefSeq) calcineurin B homologous protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
pcf  Polistes canadensis
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcf01009]
    106783676
Protein phosphatases and associated proteins [BR:pcf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     106783676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 106783676
NCBI-ProteinID: XP_014597922
LinkDB All DBs
Position
Unknown
AA seq 189 aa AA seqDB search
MGNKSSLLLREEEIAQIQEATGFTPNQIERLYSRFTSLDRGDCGTLSREDFLRIPELAIN
PLGDRIVNAFFDESGNDRVNFLQFMQVLAHFRPIKKNSPNRLNSRQEKLKFAFKMYDLDN
DDLISKDELLAILHMMVGANISAEQLTSIAERTIVEADENGDGMISLEEFCKVLERTDVE
QKMSIRFLS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggaaataaatctagtcttctattacgtgaagaagaaatagctcaaattcaagaagca
acaggatttactccaaatcagattgaacgcttgtatagccggtttactagtctggatcgt
ggagactgtggtacattaagtcgagaagattttctcaggattccagaacttgcaataaat
ccacttggtgacagaatagtgaatgccttttttgatgaaagtggaaatgatagagttaat
tttttacaattcatgcaagtactagcacattttagaccgataaaaaaaaacagtcctaat
agattaaattcaagacaggaaaaattaaagtttgcttttaaaatgtatgacttggataat
gacgatttaatatctaaagatgaactactggctattttgcacatgatggttggagctaat
attagcgcggaacaactcaccagcattgcagaacgtacgattgttgaagctgatgaaaat
ggagatggtatgatttctttggaagaattttgcaaggtactggaacgaacagatgttgaa
cagaaaatgtctataagatttcttagctaa

DBGET integrated database retrieval system