KEGG   Polistes canadensis: 106784426Help
Entry
106784426         CDS       T05611                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pcf  Polistes canadensis
Pathway
pcf03030  DNA replication
pcf03410  Base excision repair
pcf03420  Nucleotide excision repair
pcf03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106784426
   03410 Base excision repair
    106784426
   03420 Nucleotide excision repair
    106784426
   03430 Mismatch repair
    106784426
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pcf03032]
    106784426
   03400 DNA repair and recombination proteins [BR:pcf03400]
    106784426
Enzymes [BR:pcf01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106784426
    6.5.1.6  DNA ligase (ATP or NAD+)
     106784426
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     106784426
DNA replication proteins [BR:pcf03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    106784426
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     106784426
DNA repair and recombination proteins [BR:pcf03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     106784426
   NER (nucleotide excision repair)
    Other NER factors
     106784426
   MMR (mismatch exicision repair)
    Other MMR factors
     106784426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme DUF4116
Motif
Other DBs
NCBI-GeneID: 106784426
NCBI-ProteinID: XP_014599422
LinkDB All DBs
Position
Unknown
AA seq 935 aa AA seqDB search
MLKLISFYKQALPLSVLLFARVKFERQVRKIILNNSFNYLYISTSLKREKDLISKKDISP
KKKLNPEKENGKGKRKRLDSPSDTSSINKKSSKSTKKNEDSEEAINTTPKSTQEKRKNKR
SCTPKKAIKKFKRIQQPSDSSPESESTAIEESAKSVEKNEKNGEKESKVSTEFQSNNSKS
NEENHESLLDSSEDAGNEEEKNISGQKSDTESNSEDEKKVNKSIITKKTDKKTLENSSEN
EKEIVKKSKTSKKADKETHNFFAPKGAPKPDTEDSKKSAVDSYDPSAINYDPINDACWKK
DEMVPYIALTRTLELIEETSARLKIIDILSNYFRSVIVLSPNDLLPSIYLCLNQLAPAYE
GIILGVAETNLLKAIAQCTGRTLAQLKADVQSVGDIGIVAEGSRSNQKTMFQPAPLTVSR
VYTSLKEIAQMIGHSSLSKKLNKIQSLFVACRLTEARFFIRSLAGKLRVGLAEQSLLQAI
ALATTKTPPEQDYPFEILDVSKNMSRDSFKQKYDEIAFIIKTTYCECPNYDLIIPVLLKE
GVQALPEKCKITPGIPIKPMLAHPTKGIQEVLTRFEGLEFTCEWKYDGERAQIHFKDNGE
ISIYSRNQENNTSKYPDIIARFKNTRKENVTNCILDCESVAWDNEKKQILPFQVLSTRKR
KNANEADIKVQVCVFMFDLLYLNDESLVQKPFQERRQLLKECFTEVEGEWTFATSLDTSK
MEEVQEFLEESVKGNCEGLMIKTLEKEATYEIAKRSRNWLKLKKDYLDGMGDTLDLVVIG
GYIGKGKRTGIYGGFLLACYDKENEEYQSLCKIGTGFSEEDLQKHTEFFKEHLITQSKSY
YRFDSSHEPDHWFEPVQVWEIKCADLSLSPVHRAAIGIVDSEKGISVRFPRFIRVRDDKN
TEDATTAQQVAEMYNSQEQIKNKSTDVNKMEEDFD
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaattaatatcattttacaaacaggcacttcctttgtctgttttattatttgca
cgtgtaaaatttgaacgtcaagtgcgtaaaataattttaaacaatagttttaattacttg
tatatcagtactagcctcaaacgtgaaaaggatttaatatctaagaaagatataagtcct
aagaaaaagttaaatcctgaaaaagaaaatggaaaagggaaacgaaaacgactggatagt
ccaagtgacacaagttctattaacaaaaaatcttctaagtcgactaaaaaaaatgaggat
tcagaagaagcaattaatacaactcctaaatcaactcaagaaaagagaaagaataagaga
tcttgtacgcctaagaaagctattaaaaagtttaaaagaatacaacagccatcagattca
agtcctgaatctgaatcaactgcgatagaagaatctgcaaaatctgtagagaaaaatgag
aaaaatggggaaaaagaaagcaaagtttcaacagagtttcagtcgaataattctaaaagt
aatgaagaaaatcatgaatctttattagatagttccgaagatgccggtaatgaagaagag
aaaaatatttctggacaaaaatctgatactgaaagtaattcagaagatgaaaaaaaagta
aataaatctataattactaaaaagacagataaaaaaactcttgaaaatagttcggaaaat
gaaaaagaaattgtcaagaaatctaaaacttctaaaaaagctgataaggaaacccataat
ttctttgcacccaaaggtgctcctaaacctgatacggaggatagcaaaaaatctgctgtt
gattcttacgatccaagtgcaattaattatgatccaattaatgatgcttgctggaaaaag
gatgaaatggtgccatatattgcattgaccagaactttggagttgatagaagaaacaagt
gcgagattaaaaattattgacatattatcgaattactttcgttctgtcatagttttaagt
ccaaacgatttattacccagtatatatttatgtttgaatcagttagcacctgcatatgaa
ggtattattttaggagtggcagaaactaatcttttgaaagcaatagcgcaatgtactggt
agaacattggctcagttaaaagcagatgtacaaagtgttggtgatattggtattgttgcg
gaaggaagtcgttcaaatcagaaaaccatgttccaaccagcaccgcttacggtatctcgt
gtatatacaagcttgaaagaaattgcacaaatgataggccattcttctctttcaaagaaa
ttgaataaaattcagagtctcttcgttgcatgtcgtttgactgaagctagattcttcatt
agatctttagctggcaaacttcgagtgggtttagcagaacaatctcttttgcaggcaata
gcattagcgactactaaaacaccacctgaacaagattatccatttgaaattttagatgtc
agtaaaaatatgtcacgtgatagtttcaaacaaaaatatgatgaaattgcttttataata
aaaactacttactgtgaatgtcctaattatgatttgattataccagtgctgctaaaagaa
ggagttcaagctctacccgaaaaatgtaaaattacaccaggaataccaattaaacctatg
ctagcacatcccacaaagggaatccaagaagttttgacgcgattcgaaggtttggagttt
acgtgcgagtggaaatacgacggtgaaagagcacagattcattttaaggacaatggtgaa
attagtatttatagtaggaatcaagaaaataatacttctaagtatcctgatattatcgct
cgtttcaaaaatacacgcaaagaaaatgttacgaattgtattcttgactgtgagtcagtg
gcttgggataacgaaaaaaaacaaattcttccattccaagtgttgagtacacgtaaacgc
aaaaatgctaacgaggcggatatcaaagtacaagtctgtgtatttatgttcgacttatta
tatttgaacgacgaatctctcgttcaaaagccgtttcaagaacgtcgtcaacttttaaaa
gaatgtttcacagaagtagagggagagtggacatttgctacaagtttggatacgtcgaaa
atggaagaagttcaagaatttttggaagaatccgtaaaaggaaattgtgaaggacttatg
attaaaacattagaaaaagaagcaacgtacgaaattgctaaacgttctcgaaattggttg
aaattgaaaaaagattatttagatggaatgggtgatacattagatttagtagtaattggt
ggatatattggaaaaggaaagagaactgggatttatggaggtttccttttggcttgttat
gataaagaaaatgaggagtatcagagtttgtgtaagattgggactggattcagcgaagaa
gatctacaaaagcatacagaattttttaaagaacacttgataacgcaatcaaagtcgtat
tatcgttttgattctagtcatgagccggatcattggtttgaacctgttcaagtttgggaa
attaaatgtgctgatctttctttgtcacctgttcatagagctgctataggaatcgttgat
tcagaaaaaggcatatcagttcgatttccacgatttatacgtgtgcgtgatgataagaat
accgaggatgctacaactgcacagcaagtagcagagatgtataatagtcaagaacagatt
aagaataaatcaaccgatgttaacaaaatggaagaagattttgattaa

DBGET integrated database retrieval system