KEGG   Polistes canadensis: 106784449Help
Entry
106784449         CDS       T05611                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pcf  Polistes canadensis
Pathway
pcf04146  Peroxisome
pcf04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106784449
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    106784449
Enzymes [BR:pcf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     106784449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 106784449
NCBI-ProteinID: XP_014599480
LinkDB All DBs
Position
Unknown
AA seq 155 aa AA seqDB search
MPVKAVCVLQGESVKGTLFFEQANESQPVKVTGEVTGLQKGLHGFHVHEFGDNTNGCTSA
GPHFNPHGKDHGGPNDAVRHVGDLGNVEADTKGVAKVNITDKIIQLQGEHNIIGRTLVVH
GDPDDLGKGGHELSKTTGNAGARLACGVIGITKSA
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgccggttaaagcagtttgtgtacttcaaggtgaatccgttaagggaaccttatttttt
gaacaagctaatgaatcgcaaccggtaaaagtaaccggagaagttactggacttcaaaaa
ggattgcacggatttcacgtacacgaatttggagacaatactaatggctgcacgagcgct
ggtcctcatttcaatcctcatggaaaagaccacggtggtccgaatgatgctgtacgtcat
gttggagatttaggaaatgttgaagctgataccaaaggtgttgccaaggtcaacataact
gacaaaattatacaacttcaaggagaacacaacataattggcagaacccttgtggttcat
ggtgatcctgatgaccttggtaaaggtggtcatgaattgtcaaaaactactggaaatgca
ggagctcgtctcgcatgtggtgtcatcggcattacaaaatctgcttaa

DBGET integrated database retrieval system