KEGG   Polistes canadensis: 106784577
Entry
106784577         CDS       T05611                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pcf  Polistes canadensis
Pathway
pcf00230  Purine metabolism
pcf01100  Metabolic pathways
pcf04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106784577
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    106784577
Enzymes [BR:pcf01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     106784577
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF2258
Other DBs
NCBI-GeneID: 106784577
NCBI-ProteinID: XP_014599783
LinkDB
Position
Unknown
AA seq 994 aa
MSQRLEATNEESYLNSGRPSNLLRTSFNNVKLERLYRASSLQQRRGGLQCFLLSAVLYGT
YTVASPEPELPARGLTAVFIGLNLGLLAWAEHGTRARDGLWAAVPHVAWWLSTGQLLAQL
FLKSSEVTPRDGLGWLLLFLYLLFATLPLRLSFCFLLAIATAAAYMVTVFRLSKVPILSA
IDVLILTVTLSAGVAILGASSYSLAEFQQRRAFLETRQSLEVQLVIEEQSAEQERLLLSV
LPEHVAVKMRQDLGACKDTQFKKIYMSRHENVSILYADIVGFTAISSTYSASELVKILNE
LFARFDQLSERYEQLRIKILGDCYYCISGAPIERPDHAILCVHMGLSMVEAIKYVQQTTN
SPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGRAGRVHVSNVTLSFLND
EFEIEPAFGEKREEALKKAGIVTYFIVRALKPFKPAITKSLASLNDEISRRTMDNNQERR
SNKEDSEEFRQRLRKEMDSKGGGADLKGHVSWLTLRFKDPIVEKAFHSAKEAFSPLSLLG
GPLVMMCASPVWRLHPWGPFTWGGAGVVVLFGVVLAGATCLGSAVRATWLRRTLALLMTF
SLTDFLLLDMCNCAIIDEIEPKGNISYWMRCPYPSYYSYIGVLALVAISMPTYICYLGKA
LLMYILAGAQCAINILFLGSSLELEEMATLPPDPITYSLKYSLSASLLTIATALVIVARY
AEKARRMLYLRGREVAAQRERAADMKRRNGALIYNILPPHVAIYFLSRARHHDDLYSQSY
AEVGVLFASMPNFADFYSEESINNQGLECLRFLNEVISDFDAILDQNKFKDIIKIKTIGS
TYMAASGITESRESEDSPRWTHLSILVEFALELKKALSGINEQSFNHFVLKMGINHGPVT
AGVIGARKPHYDIWGNTVNVASRMESTGKVGCIQVTDETRMILEPFGFGFEQRGLVFVKG
KGQLLTHYLVSKDGVSLELDSDLPVEPTHPIIYQ
NT seq 2985 nt   +upstreamnt  +downstreamnt
atgtcccagagattggaggctacgaacgaggagtcttacctgaactccggcaggccgtcg
aatttgttaagaaccagtttcaataacgttaaacttgaacgactttatcgtgcctcatcc
cttcaacaaagacgcggtggccttcagtgcttccttttatcagctgtcctatacgggact
tatacggtagcctcacctgaaccggaactaccagctcgagggttaaccgctgtcttcatc
ggtctgaacctgggtttattggcatgggcggaacacggaacacgggccagagacggcttg
tgggccgcggttccccacgtggcatggtggctttctacgggacagttgctcgctcagctg
tttctcaaatcgagcgaggtcacgcccagggatggactaggatggctcctgctcttcctt
tatctcctattcgcaacattaccccttagattatccttctgcttcttattagcgattgct
acggctgctgcttatatggtcaccgtttttagactctccaaagtaccaattctatcggcc
atcgatgttctgatcctgacggtgacactctcggccggcgtcgctattttgggtgcttcc
agttactccctggcggagtttcagcaacgccgagcatttctcgagacaagacaaagtttg
gaagtacaattggtaatcgaagaacagagtgccgaacaggaaaggctacttctcagtgtc
ctaccggaacacgtggccgtcaaaatgcgtcaggatttgggtgcatgcaaggacacgcaa
tttaaaaagatctacatgtcgagacacgaaaatgtttcgatactttatgccgatattgtt
ggtttcacagcaatatcatctacctacagcgctagcgaactggttaaaatactcaacgag
ctgtttgcacgattcgatcaactcagcgaacggtacgaacagttacgcatcaaaattctt
ggtgattgttattattgcataagtggtgcacccatagaaaggccagatcacgcaatactt
tgcgttcacatgggtctttcaatggtcgaggctataaaatatgttcaacaaacaacaaat
agtccggtagacatgagggtaggcatacatacaggcgctgtcctggcaggtgttcttggt
caacgacaatggcaattcgacgtttacagtaaagacgtcgaactagctaataaaatggaa
agcagcggaagagccgggagagtacacgtttccaacgtaactttgagctttctcaatgat
gaatttgaaattgagccggcttttggtgagaaaagggaagaggcacttaagaaggctgga
atcgtcacgtactttatagtcagagctttgaaacctttcaaaccggcgataacgaaaagt
cttgcatcgttgaacgacgaaatttctcgaaggacaatggacaataatcaagaaaggaga
agtaataaagaagattccgaagaattcaggcaaagattgagaaaggaaatggatagcaaa
ggaggtggtgctgacctgaagggtcacgtatcgtggctaacattgcgtttcaaagatcca
attgtggaaaaagcctttcacagtgcaaaagaggccttctcacctttgtctttgctcggt
ggccctttagtgatgatgtgtgcatcaccggtatggagattacatccatggggacctttc
acttggggtggtgcaggcgtggtagtactctttggggtggtactagccggtgccacgtgt
cttgggagtgcagtaagagcgacttggttgagaagaacattagcattgttgatgaccttt
tctctaactgatttcctacttctcgacatgtgtaactgtgcgatcatcgatgaaattgaa
ccaaaaggaaacatctcgtattggatgcgttgtccttatccttcttattattcttatatt
ggtgtgcttgcccttgtagcgatctctatgccaacatacatctgttatcttggaaaggca
ttgctaatgtacattctagccggagcacaatgtgctattaatatattatttctcggatca
tctctggaattggaagaaatggccacgttaccacctgatcctatcacatattcattaaaa
tattccttgtcagcttcgttgctcaccatcgccactgccttggtcatcgtagctagatac
gccgaaaaagcaagaagaatgctgtatcttcgaggtcgagaggtagcagctcaaagagaa
agagctgccgatatgaaacgaagaaatggcgcattaatatataatatattaccgcctcac
gtagcaatttattttctctcaagagcgaggcatcacgatgatctttatagtcaaagttat
gccgaagtcggtgtattatttgcaagtatgcccaactttgccgatttttacagcgaggaa
agtatcaataatcaaggactcgaatgtctaaggttcctcaacgaagttatttccgatttt
gatgctatcttggatcaaaacaaattcaaagacatcattaagatcaaaacaataggctca
acttacatggctgcctcgggtataactgaatcccgagagtctgaggatagtccacgatgg
actcatttatcgattctcgtagaatttgctttagaattaaaaaaagctctttcgggaatc
aacgaacagagtttcaatcattttgtcctaaaaatgggtatcaatcatggcccggtaact
gctggtgtgattggtgctagaaaacctcattacgatatttggggtaacacggtaaacgtt
gcttcgcgaatggaaagcaccggaaaagttggatgtattcaggttactgacgagacccga
atgattttggaaccttttggatttggtttcgaacaacgtggcctcgtctttgtcaaagga
aagggtcaactactcactcattatttagtatctaaagatggtgtgtcccttgaacttgac
agtgatcttcctgttgagccgactcatccaattatttatcagtaa

DBGET integrated database retrieval system