KEGG   Polistes canadensis: 106786252Help
Entry
106786252         CDS       T05611                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
pcf  Polistes canadensis
Pathway
pcf00562  Inositol phosphate metabolism
pcf01100  Metabolic pathways
pcf04068  FoxO signaling pathway
pcf04070  Phosphatidylinositol signaling system
pcf04140  Autophagy - animal
pcf04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106786252
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106786252
   04070 Phosphatidylinositol signaling system
    106786252
   04150 mTOR signaling pathway
    106786252
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106786252
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcf01009]
    106786252
Enzymes [BR:pcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106786252
    3.1.3.48  protein-tyrosine-phosphatase
     106786252
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     106786252
Protein phosphatases and associated proteins [BR:pcf01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    106786252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase DSPn
Motif
Other DBs
NCBI-GeneID: 106786252
NCBI-ProteinID: XP_014602908
LinkDB All DBs
Position
Unknown
AA seq 588 aa AA seqDB search
MGLCFSCRRPTSSRLNSKISEHISASVTPLHVCLEEQRGPELGLCDASAHKPQVKKVSEN
YKAQEEAAEEKLEIGLVVIDIEEVELNPPSMANTISNMKMTNPIKGLVSKRRKRFKEDGF
DLDLTYIRDNLIAMGFPAEKLEGVYRNHIDDVVKLLESKHKDHYKIYNLCSERSYDFNKF
KQRVATYAFEDHNPPRLEQIKPFCEDVHKWLSLHKENVAVVHCKAGKGRTGVMVCCYLLH
SKQFSTATDALNYYGTKRTHDRKGVTIPSQRRYVSYYATLVQEGLNYQPITLILRKIQLD
PVPIFNGGQGYLHFVISESNKKVFSSEVHEVRKGMHSICIPLQHNVPLTGDIRVDFYNRP
KMKRKEKLFHFWFNTFFVREHVSSEYDNGELPVERSTRALSCDGTAMELPMVMSHVKPRT
GSLASLGPMPPTLVLNIDKWGLDDAHKDKHDKIYSADFKVSLFMHRVGGSNSPAVPATTN
RLGEGVQIGMGGQETPSESSEADSSECDTTGDEDGWESGESSASLVVNHHNLTHSSSHTH
VNTHQRISLRETAKGLLSRGDKSRGSPRQSTASVKRSSTFVRSSTLDT
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgggtttatgcttttcctgcaggagacctactagtagcaggttgaacagtaagatctct
gagcacatttcggcttctgtaactccgctccatgtttgtctggaggaacaaagaggacca
gaactgggcttatgtgacgcctcagctcacaagccacaggtcaaaaaggtttctgaaaat
tacaaagcacaagaagaggctgcagaggaaaaattggagattggactagttgtaattgat
atcgaggaggtggagctaaacccacctagcatggccaatactattagtaatatgaaaatg
actaaccccataaaggggcttgtcagcaaacgtcgtaaacgtttcaaagaagatggcttt
gatcttgatctcacatatatacgagataatttaatagctatggggtttcctgctgaaaag
ttggaaggagtatacagaaatcatattgatgacgtcgtcaaactgctggaatctaaacat
aaagatcattataaaatttataacttatgttccgagaggtcctatgattttaacaagttt
aagcaaagagttgctacatacgctttcgaggatcacaatccaccaaggttggaacaaatc
aagccattttgcgaagacgtacacaagtggctttctttgcataaagaaaatgtagcagta
gtacactgtaaagcaggtaaaggacgaactggcgttatggtatgctgctaccttcttcac
agcaaacagttttccactgccacggatgctcttaactattatggtaccaaaagaacacac
gataggaaaggagtaacaataccttctcaaaggaggtacgtgagttattatgctactctc
gttcaagagggtctaaattaccagccaattacattaattctacggaaaattcaattggat
ccagttcccatttttaacgggggccaaggctatctgcattttgtaatatcagaatcaaat
aagaaggtatttagttcagaagttcatgaggtacgaaaaggaatgcattctatttgtatt
ccattacaacataatgtgcctctaacaggtgatattcgagtggacttctataataggcca
aaaatgaagagaaaggaaaagctgtttcacttttggtttaatacatttttcgtacgcgaa
cacgtgtcatccgaatacgataacggcgaattaccggttgaacgatctacgagggcattg
agctgcgacggtacagccatggaattaccgatggtcatgtcacacgttaagcctcgaaca
ggatctctagctagccttggacccatgccacctactcttgttttgaacatagacaagtgg
ggcttagacgacgcacataaagacaaacatgacaaaatctacagtgcagattttaaagtt
agtttatttatgcaccgagttggtggaagtaattcgccggctgtgccagcgacaacgaat
agattgggagagggtgtacaaataggaatgggtggtcaagaaacgcccagtgaatccagt
gaagcagatagcagtgagtgcgatacaacgggagacgaagatggttgggaatctggtgag
tcttctgcatctctggtggtgaatcaccacaatcttacacacagcagtagccatacacat
gttaatacccaccaaagaattagtctcagagaaacagctaaaggtctactctcgcgtgga
gataaaagtaggggtagtcctaggcaaagcactgctagtgtaaaacgttcttcaacgttt
gtacgttcatccacgttagatacatag

DBGET integrated database retrieval system