KEGG   Polistes canadensis: 106787394Help
Entry
106787394         CDS       T05611                                 

Definition
(RefSeq) SWI/SNF complex subunit SMARCC2 isoform X1
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
pcf  Polistes canadensis
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pcf03021]
    106787394
   03036 Chromosome and associated proteins [BR:pcf03036]
    106787394
Transcription machinery [BR:pcf03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     106787394
Chromosome and associated proteins [BR:pcf03036]
 Eukaryotic Type
  Chromatin remodeling factors
   BAF complex
    106787394
   PBAF complex
    106787394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_2 SWIRM SWIRM-assoc_3 SWIRM-assoc_1 Myb_DNA-binding Myb_DNA-bind_6
Motif
Other DBs
NCBI-GeneID: 106787394
NCBI-ProteinID: XP_014605203
LinkDB All DBs
Position
Unknown
AA seq 987 aa AA seqDB search
MLALGPKKDGGPNAKFFESAEILAQLDGVKQWLLKNCKKYVQTDPPTNKSLATLVVQLLQ
FQEDNLGKNVTKPPMTRVPMKCFLDFKPGGGLCHILSTAYRFKQEQGWRRFDFPVGKSGS
RMDRIVEMLMAAERALTQNRCLTIPSVFVRADVDKPTATKVKEAVRRHQGTVVENEADAT
HIIFPSVDPMEEECARPCMRRERSVLLHWYYFPDSYDSWTTLDLPWEFPEGTLNITSTRS
VYKVSATWALDLDLYNEWMNEEDYEVDDSGQKKVHKYRLLVEDLMAQPAHPPSGKKPKRK
RSPSPLPKLGKRKSSRAPSNLQSTSSTSSAATPKKSRGTGDEEEDLTQGMEDPPAEPRIV
EVVAAPANPPITGQNSNATTSSSLASTGNKKQDNELQPLKSGNMADLDEPIEAGDKGSSQ
GTQDREERDTSKERGEGGKGDEPEDNVTEQTHHIVVPSYSAWFDYNSIHTIEKRALSEFF
NGKNKSKTPEIYLAYRNFMIDTYRLNPTEYITSTACRRNLAGDVCAIMRVHAFLEQWGLI
NYQVDAESRPTPMGPPPTSHFHVLSDTPSGLAPVNPNPPKTPQPSAAKTLLDLEKKSTAI
LGTEEKVSANAMSNFGLKVDQYSRKPAVLKNKQAAGATRDWTEQETLLLLEGLELHKDDW
NKVCEHVGSRTQDECILHFLRLPIEDPYLEEGGPEGLGPLAYQPVPFSKAGNPVMSTVAF
LASVVDPRVAASAAKAAMEEFAAIKDQVPAALLDQHLRNVQASANSDGKFDPAAGLAQSG
IAGTGSPEPPDDTTTPSTTGTQASSVTSPHSTGPASIEAKKEDQEKSKDASDVEQSPLEI
TKKEDDSKESEDDTKSSVDAEAIEAKEKKDKVVRDAQLQSAAAAALAAAAVKAKHLAAVE
ERKIKSLVALLVETQMKKLEIKLRHFEELETTMEREREGLEYQRQQLITERQQFHLEQLR
AAEFRARQQAHQRLAQEQQQHTPPEQT
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcgttaggcccaaaaaaggatggaggaccgaatgccaaattttttgaatctgcg
gaaatcctcgcacaacttgacggtgttaaacaatggcttttaaaaaattgtaaaaagtat
gtacaaacagatcctccgacaaataaaagtttagcaacattagtcgtacaattgctgcag
ttccaagaggataatttaggaaaaaatgtaaccaaaccacccatgacaagggtaccgatg
aaatgtttcttagactttaaacctggaggtggtttgtgtcatatactttctaccgcttat
cgatttaagcaagaacaaggatggcgtaggtttgactttccagttggaaagtcaggctct
cgtatggatcgcatagtagaaatgttaatggcagcagagcgtgctttaactcagaataga
tgtttgactatacctagcgtctttgtaagagccgacgtcgataaaccaacggcaacaaaa
gtaaaagaagcagtaagacgacatcaaggcacagttgttgagaatgaagcagatgctaca
catattatttttccatcagtagatccaatggaagaagaatgcgctagaccatgtatgaga
cgtgaaagatcggttcttcttcattggtattacttcccagatagttatgactcttggact
actctagatcttccttgggaatttcctgaaggaactcttaatattacaagtacaagatca
gtgtataaggtttccgcgacgtgggcgctcgatttagatttatataatgaatggatgaat
gaagaagattatgaggtagatgatagcggacaaaagaaagttcacaaatatagactttta
gtagaagatttaatggcccaacctgctcatccaccatcaggaaaaaaacccaaaagaaaa
agatccccaagtccactaccaaaacttggaaaacgcaaaagtagcagggctccatcaaat
ttacaaagcacttcatcgacttcttcggcagctactccaaagaaatcccgaggtactgga
gatgaggaagaagatcttacccaagggatggaggatccaccagctgaacctcgcatcgtc
gaagttgttgccgctcctgctaatccgccaataacaggccaaaacagtaatgcgacgaca
agcagtagtttggcatcaactggaaataaaaaacaggataatgaactgcaacctcttaaa
tctgggaatatggcagatttggatgagccgatagaagcaggcgacaaaggtagctctcag
ggaactcaagacagagaggaaagagatacgagcaaagaaagaggagaaggaggtaaagga
gacgagccagaagataatgttacagaacaaactcatcatatagttgtaccaagttattca
gcctggttcgactacaattcaattcatactatagagaaaagagcattatctgaattcttc
aatgggaaaaacaaatctaaaacacctgaaatttatcttgcgtacaggaattttatgata
gatacctatagattaaatcctacagaatatattacatcaacagcttgcaggcgtaattta
gctggagatgtttgtgcaattatgcgtgttcatgcttttctggaacaatggggtttaatt
aattatcaagtagatgcagaatctagacctacacctatgggtccaccaccaacatctcat
tttcacgtattatcggatactccatcaggtcttgcaccggttaatccaaatccaccaaaa
acaccgcaaccatctgcagcaaaaacattgcttgatcttgagaagaaatctactgctata
cttggaacagaagaaaaagtttcagctaatgctatgtcaaactttggtttaaaagttgat
cagtattctaggaaacctgcagtgttaaagaacaaacaagcagctggagcaacacgtgac
tggactgaacaagaaacacttttattattggaaggcctagaacttcataaagatgattgg
aataaagtctgcgaacatgtcggttcaagaacacaagatgaatgcatattacatttctta
cggttacctatagaagacccgtatcttgaggaaggtggtccagaaggcttaggacctcta
gcgtatcaaccagtacctttttcaaaggctggaaatccagttatgagtacagtagccttt
ttagcttcagtcgtagatcctagagtggcagctagtgcagctaaagctgctatggaagaa
tttgctgctattaaggatcaagtaccagcagcgttattggatcagcatttacgaaatgtt
caagctagtgctaactcggatggaaaatttgatccagctgctggacttgcacaatcaggc
attgctggtacaggatcacctgaaccacctgatgatactacaacaccgtcaactactgga
actcaagcatcatctgtaacttctcctcattcgacaggtccagcttctatagaagcaaag
aaagaagatcaagagaaatcgaaggatgcatcggacgttgaacaatcaccattagagata
actaagaaagaagatgattctaaagaaagcgaagatgatactaaatcttctgtcgatgct
gaagctattgaggcaaaagaaaaaaaggataaggttgtgagggacgcccaattacaatcc
gcagcagcggccgcattggctgccgctgccgttaaagcgaaacatttagcggctgtagaa
gaacggaaaataaaatcgttagtcgcgttactggtcgaaactcagatgaaaaagttagaa
ataaagttacgtcattttgaggaattagaaacaacgatggaacgcgaacgcgagggactt
gaatatcaaaggcagcaacttattactgaaagacaacaatttcatttagaacaactaaga
gcggctgaattcagagcacgacaacaagcacatcaacgtttagctcaagaacaacaacag
catacacctccggagcaaacataa

DBGET integrated database retrieval system