KEGG   Polistes canadensis: 106788119
Entry
106788119         CDS       T05611                                 

Definition
(RefSeq) uncharacterized protein LOC106788119
  KO
K16679  wengen
Organism
pcf  Polistes canadensis
Pathway
pcf04013  MAPK signaling pathway - fly
pcf04214  Apoptosis - fly
pcf04215  Apoptosis - multiple species
pcf04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    106788119
   04391 Hippo signaling pathway - fly
    106788119
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    106788119
   04215 Apoptosis - multiple species
    106788119
SSDB
Motif
Pfam: TNFR_c6 Trp_oprn_chp CD225
Other DBs
NCBI-GeneID: 106788119
NCBI-ProteinID: XP_014606587
LinkDB
Position
Unknown
AA seq 316 aa
MPKESCWGLLLTLVPLFVGVCDLAGAISGSQYPVCKPGLEFWSTERASCWPCTRCAPEFT
LSPCAVHKDAICGPLSALELDWSFLSTRKRPENGQRRLEAVTSKMLWRFPDLDQQQQQQS
QEQRQQEKLKQETRSLVDATYDDEINVGHVDELSSQEQKRSYDPRERRKSNIHEGNLLWD
WQTAALVLAVCACVVFFLVAGCSALVYARQWRRMKKSFEPVGLEEISARLNVMVKAELAE
LVAGAPMSPGDPETRCQYLEKLLDRKRETPVVAGWPEVGGNLYIEEEETLRSKRSQIARI
HRNIETILSHKTNVID
NT seq 951 nt   +upstreamnt  +downstreamnt
atgccaaaggaatcttgttgggggttactgctaaccctagtgccgttattcgtcggtgtc
tgtgatctcgctggcgcaatatccggttctcagtatccggtgtgtaaaccaggcttagaa
ttctggtccaccgagcgtgcatcttgctggccatgcacgagatgcgcgcccgagttcaca
ttgagcccttgcgccgtgcataaagatgcaatttgtggtccactatcagctttggagctt
gactggtcttttctttcaacgagaaaaaggcctgagaacggacagagacgtttggaagcg
gtaacatcaaagatgctttggcgatttcctgatttagatcaacaacaacaacaacagtcg
caggagcaacgacagcaagagaagttaaaacaggaaacgaggagtctcgtcgatgctact
tacgacgacgaaataaacgtgggacacgttgacgagttatcttctcaagaacaaaaaagg
tcatatgatcctcgagaaaggagaaaatctaatatccacgaaggaaatcttttgtgggat
tggcaaactgccgcccttgtattagcggtatgtgcctgtgtggtcttctttttggtagcg
ggttgttcggccttggtttatgcgagacaatggcgaaggatgaaaaaaagttttgaacca
gtcggtctcgaagaaatctctgcccgattaaatgttatggttaaggcagaattggctgaa
ctcgttgcgggtgcacctatgagtccaggtgatccagaaactagatgtcagtaccttgag
aaattattagaccggaaacgcgaaactccggtggtggctggttggccggaagtgggtggg
aacctctacatcgaggaagaggagacactgagaagtaaacgttcacaaatcgcgcggatt
catcgaaacatcgaaacgattctcagccacaagactaacgtcattgattga

DBGET integrated database retrieval system