KEGG   Polistes canadensis: 106789144Help
Entry
106789144         CDS       T05611                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
pcf  Polistes canadensis
Pathway
pcf00480  Glutathione metabolism
pcf00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106789144
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    106789144
Enzymes [BR:pcf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     106789144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-GeneID: 106789144
NCBI-ProteinID: XP_014608592
LinkDB All DBs
Position
Unknown
AA seq 239 aa AA seqDB search
MSTKHLSTGSICPPIVPGKIRLYSMRFCPYAQRVHLVLDAKKIPYDVVYVNLTQKPEWLL
EKNPCGKVPCIELNGGEVLHESLIITEYLDEAYPQNKLYPLNPLTKAKDKLLIEKFNGVI
TNMYKLYAGTTVDCDIFNEALASLEFFDRELVKRRTPFFGGSSPGMLDLMIWPWCERADI
IRILRGDEFTISRERFLRLFEWRSAMKEDSAVKGSYLDAEIHAKYTRSRLAGMAQYDLI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgaaacatttgagcacaggatcaatttgtccacccatcgttcctggaaaaatt
cgtttgtacagcatgcgtttttgtccatatgcccaaagagttcatctcgttttagatgcc
aaaaaaattccatacgacgttgtttatgttaatttaacccagaaaccggaatggctgtta
gagaaaaatccttgtggaaaagttccttgtatagaattaaatggaggcgaagtattgcat
gaaagtcttataataactgaatatttggatgaagcttatccacaaaataaattgtatcca
ctgaatcctttaaccaaggctaaagataaattgttgatcgaaaaattcaatggagttatt
accaatatgtacaagttatatgctggaacaacggtagactgtgatatatttaacgaagcg
cttgccagtcttgaattttttgatagagaattagttaaaagaagaactccattctttgga
ggttcttcacctggcatgttggatctgatgatctggccatggtgtgaaagagctgatatt
attaggatcttgcgtggagatgaattcacaatatctcgagaacgttttctaagactgttc
gaatggaggagtgctatgaaagaagattctgcggttaaaggaagttatttggatgctgaa
atacatgctaaatatacgcgtagtcgacttgcaggaatggctcaatatgatttgatttaa

DBGET integrated database retrieval system