KEGG   Polistes canadensis: 106790347Help
Entry
106790347         CDS       T05611                                 

Definition
(RefSeq) WD repeat and HMG-box DNA-binding protein 1-like
  KO
K11274  chromosome transmission fidelity protein 4
Organism
pcf  Polistes canadensis
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcf03036]
    106790347
Chromosome and associated proteins [BR:pcf03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    106790347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid Sugar_tr MFS_1 WD40 ANAPC4_WD40 MFS_1_like MFS_2 HMG_box
Motif
Other DBs
NCBI-GeneID: 106790347
NCBI-ProteinID: XP_014610650
LinkDB All DBs
Position
Unknown
AA seq 1423 aa AA seqDB search
MPLVKKPMRYAHPEGHTDVCYYTGEEGGLITCGSDGDVRSWLNLMDDDPTASCIAEQAIA
LISKKGKIYVGNDNNTVQILTHPDLEKEGIVTRFAAPVCALATTTNSNYIVSGGCDMRIQ
ITNINTSHSIELEGHEAPILGLSLDPKEEFVASSSADGSIRIWDIKEKCTVNIWNNVVPK
CNSFFTAKTYCTPSFHCKDGSCLAYPHNKDIIIVERLTWKESYKLQCPTLKAEFSICKFS
DCGTRLAASTVYGEIVAWNMENMALIGNIEHPQNTKITAIVWKHNASDEIAFCDFSGQLG
CIDVIVDNQSEDLQSNGLSMNNEVRETTEIPLNYINDDDDDDGDNVISLNKIKASVGYEN
DEKSDIILEKDTAHDVKNFMPEIRIQPPFQPGSSPIHLLSRFMVWNHVGIVKCFNSEDGE
ESSIEVEFHDITIHRSMHINNYLNHTIAALSSNALVLNCPSIEDTASKLVVVVLQGWGSG
NKEWSIDLPEGEDGQCVAAGDNFVAIATSRRYLRIFMIGGTQREVIALPGPVVTMNAFNN
HLVVAYHDGLGVTGDQHMSLLCIQIFGTRLRNQKLSIPLCPSSDLIWLGLSDFGSPVITD
SEDIIKIYDKKSSLWRVICDMDRKGKGKADHYFIIEVSEERKSVSCVLCKGSYYPITTPR
PVVTEISLTIPLCEPDSEKTEKETKLWQLGSQPSDENEAVLFLIALACRSNVEYRAVELC
EQIASQKVLDLAIKYAARINRTALMKKLESIADIKEKQEEEEKEEKENNDQNGTKNGDEI
IEDTEELFLTPVVNKKSDIEIRPLSMTETLSMRRSNPFLKTTTSTSTGLIGLNTAQEKPQ
RSVVEKITPSPKFKSKNEVKKETFVAWYAKQKKHLQEEFPDYKPAELTKIALSRYKEISK
TQDKEEPSEKKKRKLSNHIPLDVIQDAMGIMGPWHIVIAIALSLVKFPVAWHQLSIVFLA
PPTNFSCISPESSTNESMVMKCYVNLDNGTMEKCNKFRYDRRIFRESIITEWDLVCDREQ
LANVVQSCTMFGVLLGNFVFSSMADRIGRKKPLMIALALQSVTGVISSYAVWFELFLIFK
FLSAIATGGTMLISFVLLMEIVGIEWRSAMSILFHVPFIIGHLTTPLVSYLTHTWHKFQL
AISIPAICLLSYYWIIPESPRWLLATGKPAEAEIILLKAARRNKIPLENVNRAIDAHESQ
KLSRKIDKTNYNFTHLFRTPNMRFKSICVFINWFFCGICFFGLAQYMGHIDGNIFINVAI
SAAVELPGTIIVLFLISRVSRLKILMGANLLTGLSLLLIVIINNPNATLYLASLGIAGTG
VSFPTIYLYSSEIFPTVVRNNGIGIGSVCARFGSMIAPYIATLGKIQFWLPPVIFGLGQL
IGAGLCLLLPETINCELPETIEDGENFRKQTSAQSTSSAHNNT
NT seq 4272 nt NT seq  +upstreamnt  +downstreamnt
atgccgttagtaaaaaagcctatgcgttatgctcatccagaaggacatacagatgtttgt
tattatactggagaagagggaggtcttattacttgtggttcggatggagatgttagatca
tggttgaatttaatggatgatgatccaacagcaagttgtattgcagaacaagcaatagca
ttgatatcaaagaaaggcaaaatatatgtaggtaacgataacaatactgttcaaatactc
actcatccagatctcgaaaaagaaggaatagttacgagattcgctgcaccagtatgtgct
ttagctactacaacaaatagtaattatattgtatcgggtggatgtgatatgagaatacaa
attaccaatatcaatacatcgcatagtatagaactggaaggacatgaagcccctatatta
ggtttatctttggatccgaaggaagaatttgttgcttcttctagcgctgatggttctatt
aggatttgggacattaaggaaaaatgtaccgttaatatttggaataatgttgtacctaag
tgtaattcattttttactgcaaagacttattgtacgcctagttttcattgtaaagatgga
agttgccttgcgtatccacataataaagatataattattgtagaaagattaacttggaag
gaatcatataaattacaatgtcctactttaaaagctgaatttagtatttgcaaattttct
gactgtggcacaagattagctgccagtacagtatatggagaaattgttgcatggaatatg
gaaaatatggcattgataggaaatattgaacatccacaaaatactaaaattactgcaatc
gtgtggaaacataatgcatcagacgaaatagcattctgtgatttttcaggccagttaggt
tgcatcgatgtgatagttgataaccaatcagaagatcttcaaagtaatggactttcaatg
aataatgaagttcgtgaaactacagaaattccattgaattacattaatgatgacgatgat
gatgatggagataatgtaataagtttaaataaaataaaagcatctgtaggatatgaaaac
gatgaaaagtctgatattatattagagaaagatacagcgcatgatgttaaaaattttatg
ccagaaatacgaatacaaccaccttttcaaccaggatcttcacctattcatttattatca
cgatttatggtgtggaatcatgtaggcatagtaaagtgttttaattcagaagatggagaa
gaatctagtattgaagtagaatttcatgatattacaattcaccgcagcatgcatataaat
aattatttgaatcatactattgccgctttatcatctaatgctcttgtgttaaattgtcct
tcaattgaagatacagcaagcaaacttgtcgtagtagtattgcaaggctggggttctgga
aataaagaatggtcaatagatcttccggaaggagaagatggacaatgcgttgctgctggt
gacaattttgtagcaattgccacttctagaagatacttgagaatctttatgataggtgga
acacaacgtgaagttatagctttgcctggtcctgttgtcacaatgaatgcatttaacaat
catcttgtcgttgcttatcatgatggactaggagtaactggagatcaacatatgagttta
ctttgcatacaaatttttggaacacgtttgagaaatcaaaaattaagtattcctctttgc
ccctcatcagatcttatatggttaggattatccgattttggatctccagttataacggat
tcagaagatattataaaaatatatgataaaaaatcatctttatggagagttatatgtgat
atggatagaaagggcaaaggtaaagccgatcattattttataattgaagtaagtgaagag
cgtaaatctgttagctgtgtattatgtaaaggaagttattatccaataactactccacgg
ccagttgttaccgaaatatctttaacaattcctctttgtgaacctgattcggaaaaaaca
gaaaaggaaactaaattgtggcaattaggaagtcaaccatcagatgaaaacgaagcagta
ctatttcttattgcattggcttgtcgaagtaacgttgaatatcgagcagtcgaattatgt
gaacaaatagcatcacaaaaggtattagatttggcgataaaatatgcagcacgtattaat
cgtactgcgttaatgaaaaaattggaatccattgctgatattaaagaaaagcaagaagaa
gaagaaaaagaagaaaaagaaaataatgatcaaaatggtacaaaaaatggtgatgagata
atcgaagatacagaggaattatttttaaccccggtggtaaataaaaaatctgatatagaa
ataaggccattatcaatgactgaaactttatcaatgagaagatctaatccctttttgaaa
actactacttcaacatcaacgggtttaattggtctcaatactgcacaagaaaagcctcaa
agatcagtagtagaaaaaattacaccttctcctaaattcaaatcaaaaaatgaagtaaaa
aaagaaacgtttgttgcctggtacgcaaaacagaagaaacatttacaagaagaatttccc
gattataaacctgctgaattaacaaaaatagctttatcgagatacaaagaaatctctaaa
acacaagataaagaggaaccatccgaaaaaaagaaacggaaattgtcaaatcatattcca
ctggacgttattcaagatgcaatgggtattatgggtccttggcatattgttattgctatt
gcactttctcttgtcaaattcccagttgcttggcatcaactctcaattgtatttttagca
cccccgactaatttttcttgcatatcaccagaatcctcaactaatgaatccatggtaatg
aaatgttatgttaatcttgataacggtaccatggaaaaatgtaataaatttagatacgat
agaagaatctttcgagaaagtattataacggagtgggatttagtttgtgatagagaacaa
ttagcgaatgttgtacaatcgtgcacaatgtttggcgtactacttggtaattttgtattc
agctcgatggccgatagaatcggtcgtaaaaagccattaatgattgcattagccttgcaa
tcggtaacaggtgttattagctcttatgctgtgtggttcgaattatttctaatttttaaa
tttttgtccgcaatagctacgggtggaactatgttaattagttttgttttattgatggaa
attgtaggaatcgaatggcgatcggcaatgtctatcctctttcatgtaccgtttataatt
ggtcatttaactactcctcttgtatcttatttaacacacacgtggcataaatttcaattg
gctatttcaataccagcaatttgtttattatcttactattggataattccagaatcacct
agatggttactcgctaccggtaaaccggcggaagctgagattattttattaaaagctgcc
agacggaataagattccattagaaaatgttaatagagcgatagatgcgcacgaaagtcaa
aaactgtctcggaaaatagataaaactaattacaatttcacacatttgtttagaacgcct
aatatgagatttaaaagtatttgtgtatttattaattggttcttttgtggtatttgtttt
tttggattagcacagtatatgggtcatatcgatggaaatatatttattaatgttgctatc
tcagctgctgttgagttaccaggtaccattatagttctgttcttgatatcacgagtgtca
cgtttaaaaatattgatgggagccaatttgttgactggtttaagtttacttttaattgta
ataataaacaatccaaatgctacactttatctagcaagtttgggaatcgctggaaccggt
gtcagttttccaaccatatatttatatagcagtgaaatatttcctactgttgttagaaat
aatgggattggtataggcagtgtatgtgctagatttggaagcatgatagcaccttatatt
gctactctgggaaaaattcaattttggttgcctcctgttatatttggattaggacaatta
attggggctggtctctgccttttattaccagaaacaataaattgtgaattacccgagacc
atcgaggatggtgaaaattttagaaagcaaacttctgctcaaagtacatcttcagcacat
aacaatacttga

DBGET integrated database retrieval system