KEGG   Polistes canadensis: 106790970
Entry
106790970         CDS       T05611                                 

Definition
(RefSeq) fibroblast growth factor 13-like
  KO
K18496  fibroblast growth factor 1
Organism
pcf  Polistes canadensis
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcf04052]
    106790970
   00536 Glycosaminoglycan binding proteins [BR:pcf00536]
    106790970
Cytokines and growth factors [BR:pcf04052]
 Growth factors
  Growth factors (RTK binding)
   106790970
Glycosaminoglycan binding proteins [BR:pcf00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   106790970
SSDB
Motif
Pfam: FGF DUF3439
Other DBs
NCBI-GeneID: 106790970
NCBI-ProteinID: XP_014611748
LinkDB
Position
Unknown
AA seq 256 aa
MSLRWIHENLKAPTCDEECSDIDDSCSDDSYDTDLSFCKKESSSTSTTTTTTTINTTTSS
STKIEDEKKGLNGDSRKHKLETRKHQNTIVTYDENSQPRYETSEVTYTLSPYVIWDPRQP
AENPIYNSLVIKLYCRTGYHLGITSTGKIRGLSGTNERHALLHVTPVSFGVVRIQGVETK
LYLAFNKKGYLYGESNMNKDNTEWEQWSVGSYDAFRSRKYVHPGWWIGIKKNGRAKSGPR
TVWGQKAIQFLAIRQD
NT seq 771 nt   +upstreamnt  +downstreamnt
atgagcttaaggtggatccacgagaatttgaaagctccgacctgcgacgaggaatgcagt
gacattgacgacagttgcagtgacgacagttacgacacagatctgtcgttttgtaaaaag
gaatcatcctccacttccaccaccaccaccaccaccaccatcaacaccaccacctcctcc
tcaacaaaaatcgaggacgagaaaaagggattgaacggtgattctcgtaagcacaaacta
gaaacgaggaaacatcagaacactatagttacctacgatgaaaacagtcaaccacgatac
gagacgtccgaagttacttacaccctttcaccctacgtaatatgggatccacggcaaccg
gcggaaaacccaatttataattccctcgtcataaaactttactgtcgtaccggttatcat
ctcggaataacgtctactggcaaaattcgaggcttgtcaggaacaaacgagagacatgct
cttttacacgtaacaccagtctctttcggagtcgtacgaatacaaggtgtcgagaccaaa
ctatatcttgcattcaataaaaagggctacttgtatggagagtccaatatgaacaaggac
aatactgaatgggaacaatggtctgttggatcttacgatgcatttcgatcacgtaaatac
gtacatcccggttggtggattggtattaaaaaaaacggacgtgcaaaatccggtccaaga
acggtttggggacaaaaggctatacaatttttagcgataagacaagattaa

DBGET integrated database retrieval system