KEGG   Polistes canadensis: 106791181Help
Entry
106791181         CDS       T05611                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pcf  Polistes canadensis
Pathway
pcf00020  Citrate cycle (TCA cycle)
pcf00190  Oxidative phosphorylation
pcf01100  Metabolic pathways
pcf01200  Carbon metabolism
Module
pcf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pcf_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106791181
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106791181
Enzymes [BR:pcf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106791181
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 HI0933_like DAO FAD_binding_3 GIDA
Motif
Other DBs
NCBI-GeneID: 106791181
NCBI-ProteinID: XP_014612137
LinkDB All DBs
Position
Unknown
AA seq 626 aa AA seqDB search
MLPRCLSKLIPLPSRDYPVVDHCYDVVVLGAGGAGLRAAFGLGSKGYRVAVVTKLFPTRS
HTVAAQGGLNAAIASEHEDSWLYHMYDTVKGSDWLGDQDAIHFLTREAPRAVYELENYGC
PFSRNESGKIYQRAFGGQSLKFGKGGQAHRTCAVADRTGHALLHTLYGQSLRYDVHYYVE
YFALDLLMHGRCCKGILAWELETGILHRFRAHHTVIATGGAGRCYLSCTGAHTCTGDGMA
ISSRAGLPLQDMEFIQFHPTGMYGTGILITEGSRGEGGKLVNSQGEYFMEKYAPVAKDLA
SRDVVSRAITIEIIEGRGVGPKKDHVHLALNHIPIETLRTKLPGISHLAWVFSGVDITKD
PIPVVPTVHYNMGGIPTNYRAQVLTRENEEDSVIDGLWAAGETACASVHGANRLGANSLL
EIIVFGKAIADQIDCVTRPGERHEEISPDLGEESICRFDATRYAKGCIPVNELKQSMQQT
MHKYCSVFRTCDILQRGCREMTKLYTCDLPDICVQDQSMIWNTELVEALELQNMMLINMH
TVYAAENRKESRGSHARDDFKERIDEYDYTKPLENQKMRPYSEHWRKHTLTWAFNDGSIS
ISYRPVIDTTLDEMEAKHVPPTIRSY
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgttacctcgatgtctaagcaagttgataccacttccatcgagggattacccagttgta
gatcattgttatgacgtggtggtactaggagcgggaggtgcaggtctaagagcagcattt
ggtttaggaagtaaaggatatcgtgtagcagtagtaactaaactctttccaacgagatcg
cacacggtggctgctcaaggtggtttaaatgctgctatagcgagcgaacacgaggatagt
tggctttatcacatgtatgacacagtcaaaggatccgattggctaggagatcaggatgct
atacattttctaaccagagaagcacctcgtgcagtttacgagctagaaaattatggatgt
ccattcagtcgtaacgagtctggaaaaatttatcaacgtgcattcggtggacaatcgttg
aaatttggaaaaggtggtcaagcacatcgaacttgtgcagtagcagacagaacaggacac
gctcttctccatactttatatggtcaaagtcttcgttacgatgtacattattatgtagaa
tattttgcacttgatcttttaatgcacggtcgatgctgcaaaggaattctcgcttgggaa
ttggaaacaggaatacttcatcgttttagagctcatcataccgtgatagcaacaggaggt
gctggtagatgttatttatcttgtacaggtgcacatacttgtacaggtgatggcatggct
atatcctcaagagcaggattgccattacaagatatggaatttatacagtttcatcctaca
ggaatgtatggaactggaatattaataacagaaggaagtagaggcgaaggtggtaaatta
gtaaattcccaaggtgaatatttcatggaaaaatatgctccagtggctaaggatttagca
tcacgtgatgttgtttcccgagctattaccattgaaataattgaaggaagaggtgtaggt
cctaaaaaagatcatgtgcatctcgcactaaatcatatacctattgaaactctacgtact
aagttaccaggcatctcacatttggcatgggtattttctggtgttgacattacaaaggat
cccataccggtggtaccaacggtccattacaatatgggtggaatacctacaaattaccga
gctcaagtgttaacgcgtgaaaatgaagaggacagtgtgatagatggattatgggcagct
ggtgagaccgcatgtgcatccgttcatggtgccaatagacttggagctaacagtttatta
gaaatcattgtttttggtaaagcaatagccgatcaaattgattgcgttactagacctggt
gaacgacacgaagaaatttctcctgatttgggtgaagaatcaatttgccgatttgatgcg
acacgttatgcgaaaggttgcatccccgttaacgagcttaaacaatcaatgcaacaaact
atgcacaaatattgttcggtgtttagaacttgcgatattttacaaagaggatgccgggaa
atgacgaaactctacacctgcgatttacctgatatatgcgtgcaagatcaatcgatgatt
tggaacacagaactcgtagaagcattggaattacaaaatatgatgcttattaatatgcac
accgtatatgcagctgaaaatcgtaaagaatctaggggttcccacgcaagagatgatttc
aaagaaagaatcgacgaatatgactatactaagcctctagaaaatcaaaaaatgcgacca
tattcggaacattggcgtaagcatacgttaacttgggctttcaatgatggatcgataagt
atttcttatcggccggttattgatacgactttagatgaaatggaagctaaacacgtacca
cctaccattcgatcctattag

DBGET integrated database retrieval system