KEGG   Pseudomonas corrugata: AXG94_01200Help
Entry
AXG94_01200       CDS       T04842                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pcg  Pseudomonas corrugata
Pathway
pcg00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pcg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AXG94_01200
Enzymes [BR:pcg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AXG94_01200
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AXG94_01200
    1.1.1.-  
     AXG94_01200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C UDPG_MGDP_dh_N 2-Hacid_dh_C DAO
Motif
Other DBs
NCBI-ProteinID: AOE60447
UniProt: A0A3M3F1Z9
LinkDB All DBs
Position
306206..307300
Genome map
AA seq 364 aa AA seqDB search
MNASITPTRSMRAAVWHGRNDIRVEDVPLPVSPPAGWVQIRVQWCGICGSDLHEYVAGPV
FIPVDAPHPLTGIKGQCILGHEFCGEIVELGAGVEGFSVGEPVAADACQHCGTCYYCTHG
LYNICENLAFTGLMNNGAFAELVNVPANLLYKLPADFPAEAGALIEPLAVGMHAVKKAGS
LLGQNVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSGARKAKALEVGASHVIDPNQCDAL
AEVRRLTGGLGADVSFECIGNKHTAKLAIDLIRKAGKCVLVGIFEEPSEFNFFELVSTEK
QVLGALAYNGEFADVIAFIADGRLDISPLVTGRIQLEQIVGQGFEELVNNKEHNVKIIVS
PARI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcttcaatcacgcctacccgcagcatgcgcgccgccgtctggcatggccgcaac
gatatccgtgtcgaagatgtaccgttgcccgtttcgccgcccgccggctgggtgcagatc
cgcgtgcagtggtgcggcatctgcggctccgacctgcatgagtatgtggccgggccggtg
ttcatcccggtggacgcgccacacccgctgaccggtatcaagggccagtgcatcctcggc
cacgagttttgtggcgaaatcgtcgaactgggtgccggagtcgagggcttcagcgttggc
gagccggtggcggcggatgcctgccagcactgcggcacctgctactactgtacccacggg
ctttacaacatctgcgaaaacctggcgttcaccggcctgatgaacaatggtgcgttcgcg
gaactggtcaatgtgccggccaatttgctctacaagttgcctgccgattttcctgcagag
gccggcgcgctgatcgagccgttggcggtgggcatgcacgcggtgaagaaagccggcagc
ctgttgggccagaacgttgtggtggtgggcgccgggaccattggcctgtgcaccatcatg
tgtgccaaggccgccggggcggcccaggtgattgccctggaaatgtccggtgcacgcaag
gccaaggccctggaagtcggcgccagtcatgtcatcgatcccaaccagtgcgatgcgttg
gctgaagtgcgccgcctgaccggggggctgggcgccgatgtcagcttcgagtgcatcggc
aacaagcacaccgccaagctggccatcgacctgatccgcaaggccggcaaatgcgtgctg
gtggggattttcgaggaaccgagcgaattcaacttcttcgaactggtgtctaccgagaag
caggtgctcggcgcgctggcctacaacggcgaatttgccgatgtcattgcgttcattgct
gatggccgcttggacatttctccattggtaaccgggcgcatccagttggagcagattgtc
gggcagggattcgaggaactggtcaacaacaaggaacacaacgtgaaaatcattgtgtca
ccggcccggatctga

DBGET integrated database retrieval system