KEGG   Pseudomonas corrugata: AXG94_04645Help
Entry
AXG94_04645       CDS       T04842                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pcg  Pseudomonas corrugata
Brite
KEGG Orthology (KO) [BR:pcg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AXG94_04645
Enzymes [BR:pcg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AXG94_04645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_oxidored AlaDh_PNT_C FAD_binding_3 Thi4 NAD_binding_7 K_oxygenase Glutaredoxin FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AOE61090
LinkDB All DBs
Position
complement(1247403..1248965)
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLKDIASLSTQIILLDNGTDAR
KPSFSLNRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRALEGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDERQIMAVPSIYLNGENF
GQGRMGLEEILAKIDTSGIERQAEKISAKDAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLAVALEEHVKQYDVDIMNLQRADGLVPGTDGML
HEVRFASGARLKAKTVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFDVQLRADAVLQRKLHSLPNVTVITNAQTTEVTGDGQ
KVNGLRYKDRPSGEVLDVTLEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDARGETSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagctcagttgaagtcatatctggaacgggtcacccaaccg
atcgagatcgttgcatccctcgacgacggtgcgaaatcccaggaaatgctggcgttgctc
aaagacattgccagtctctccacccagatcatcttgctcgacaacggcaccgatgcgcgc
aagccatcgttctcgttgaaccgcccgggagccgatatcagcctgcgtttcgccggtatt
cccatgggccacgaattcacttcgctggtgttggccttgctgcaagtcggcggccaccct
tcgaaggccagtgtcgaagtcattgaacagatccgcgcccttgaaggcgagttcaacttc
gagacctatttctcgctgtcgtgccagaactgcccggacgtggtccaggcgctgaacctg
atggcggtgctgaacccgaacatccgccacgtcgctatcgacggtgcgctgttccaggct
gaggtcgatgagcgtcagatcatggccgtgccgagtatctacctgaatggcgagaacttc
ggtcagggccgcatgggcctggaagagattctcgccaagatcgataccagcggtatcgag
cgccaggccgaaaaaatcagcgccaaggacgccttcgatgtgttggtggttggcggtggc
ccggccggtgcttcggctgcgatctatgcggcccgcaaaggcatccgcactggtgtggcg
gctgaacgcttcggcggacaggtactcgataccatggccatcgagaactttatctcggtc
caggaaaccgaagggccgaaactggccgtagccttggaagagcacgtcaagcaatacgac
gtggacatcatgaacctgcaacgtgccgatgggctggtgcctggcacggacggcatgttg
catgaagtccggttcgccagcggtgcgcgcctcaaggccaagaccgtgatcctggcgacc
ggtgcccgctggcgtgaaatgaacgtgccgggcgagcagcaataccgcaacaagggcgta
gcatactgcccacactgtgacggtccgctgttcaagggcaagcgcgtggcggtgatcggc
gggggtaactccggcgtcgaagcggccatcgacctggccggtatcgtggcccatgtcacc
ttgctggagttcgatgtgcagttgcgcgccgatgcggtgttgcagcgcaaactgcacagc
ttgccgaatgtgacggtgattaccaacgcccagaccaccgaggtgacaggcgacggtcag
aaggtcaacgggctgcgctacaaggatcgtccaagcggtgaagtgctggacgtgacgctg
gaagggatatttgtgcagatcggcctgttgcccaataccgattggctcaaaggtactgta
gagctgtcaccgcgtggcgagatcatcgtcgacgcccggggtgaaacctctatccctggc
gtattcgccgccggcgatgtgaccaccgtgccgtataagcagatcgtgatcgccgtaggc
gagggcgccaaggcttcgttgagcgccttcgatcatctgatccggacttccgcgccagca
taa

DBGET integrated database retrieval system