KEGG   Pseudomonas corrugata: AXG94_05890Help
Entry
AXG94_05890       CDS       T04842                                 

Definition
(GenBank) hemolysin D
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
pcg  Pseudomonas corrugata
Brite
KEGG Orthology (KO) [BR:pcg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pcg02000]
    AXG94_05890
Transporters [BR:pcg02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   AXG94_05890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 HlyD Biotin_lipoyl_2 Biotin_lipoyl OEP HMMR_N DUF4407 Csm1_N FliJ Spc7 TPR_MLP1_2 LXG Seryl_tRNA_N SKA1 Filament
Motif
Other DBs
NCBI-ProteinID: AOE61325
LinkDB All DBs
Position
complement(1496215..1497414)
Genome map
AA seq 399 aa AA seqDB search
MATAENTQTSENQQDNNPRKRKVMLLVLAVIVILAGLGVWAWHELYGRWSESTDDAYVNG
NVVEITPQVSGTVVSIGADDGDLVREGQVLVQFDPNDAEVGLQSAQANLARTVRQVRGLY
SNVDGMRAQVNAQEAEVQKAQENYNRRKSLAAGGAISKEELSHARDDLTSAQNALANARQ
QLKTSSALVDDTVVSSHPDVQAAAAQLRQAYLADARSTLIAPVTGYVAKRTVQLGQRVQP
GTALMAVIPLDQLWIDANFKETQLRDMRIGQPVEIETDLYGSDVKYSGTIDSLGAGTGSA
FALLPAQNATGNWIKIVQRVPVRIHVNAQELAKHPLRVGLSTEVSVNLRDQSGPVLAQQP
PQKASFSTQVYDRQLADADAMITRLIHENSAAASKTAQR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgcagaaaatactcaaacatccgaaaaccagcaggacaacaacccacgcaag
cgcaaggtgatgctgctggtgctggcggtgatcgtcattctcgccggcctgggcgtctgg
gcctggcatgagctgtacggccgctggagcgaaagtacggacgatgcctatgtgaacggc
aacgtggtggaaatcactccgcaggtcagcggcaccgtagtgagcatcggtgccgacgac
ggcgatctggtccgcgaaggccaggtgctggtgcagttcgacccgaacgacgccgaggtc
ggcctgcagagtgcccaggccaacctggcccgcacggtccgccaggtgcgtggtttgtac
agcaacgtcgacggcatgcgggcgcaggtcaatgcgcaggaagccgaagtgcagaaggcc
caggagaactacaaccggcgtaagagcctggcggccggcggcgcgatttccaaggaagag
ctgtcccacgcccgggatgacctgacctcggcgcagaacgccctcgccaatgcccgacaa
cagctcaagacttccagcgcgctggtggatgacaccgtggtgtcgtcccatcccgacgtg
caggccgccgccgcacagttgcgtcaggcctacctggccgacgcccgtagcacgttgatc
gcgccggtcaccggttatgtcgccaagcgcaccgtgcaactgggccaacgggtgcagccg
ggaactgcgctgatggcggtgattccactggatcagttgtggatcgacgccaacttcaag
gaaacccaactgcgtgatatgcgcatcggccagccggtagagatcgaaaccgacctctac
ggtagcgatgtgaagtacagcggcaccattgacagcctcggcgcgggaacgggcagcgcg
tttgccttgctgccggcgcagaacgccaccggtaactggatcaagatcgtccagcgggtg
ccggtgcgcattcatgtcaatgcccaggaactggccaagcacccgttgcgggtcgggctg
tccaccgaggtcagcgtcaacctgcgcgatcagagcggaccggtcctggcccagcaaccg
ccgcagaaggcctcgttcagcacccaggtctacgaccgtcaactggccgatgccgacgct
atgatcacgcgcctgatccacgaaaacagcgctgccgcgagcaagactgcgcagcgttga

DBGET integrated database retrieval system