KEGG   Pseudomonas corrugata: AXG94_07485Help
Entry
AXG94_07485       CDS       T04842                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
pcg  Pseudomonas corrugata
Pathway
pcg00061  Fatty acid biosynthesis
pcg01100  Metabolic pathways
pcg01212  Fatty acid metabolism
Module
pcg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pcg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AXG94_07485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pcg01004]
    AXG94_07485
Enzymes [BR:pcg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AXG94_07485
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     AXG94_07485
Lipid biosynthesis proteins [BR:pcg01004]
 Fatty acid synthase
  Component type
   AXG94_07485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AOE61605
UniProt: A0A3M3DZN0
LinkDB All DBs
Position
1814776..1815291
Genome map
AA seq 171 aa AA seqDB search
MTKQNAFTREDLLRCSRGELFGPGNAQLPAPNMLMVDRITHISEEGGKYGKGELVAELDI
NPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFFLGWQGLPGRGRALGSGEVKFFGQVLPT
AKKITYNIHIKRVLKGKLNMAIADGSVTVDGREIYTAEGLRVGVFTSTDNF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaaaacgcctttacccgggaagatctgctgcgctgcagtcgcggtgagctg
ttcggcccaggtaacgcgcaactgcccgccccgaacatgctgatggtggatcgcatcacc
catatcagcgaagagggcggcaagtacggcaaaggtgaattggtcgccgagctggatatc
aatccggacctgtggttcttcgcctgccatttcgaaggtgatccggtcatgccgggctgc
ctgggcctggatgccatgtggcagctggtcggctttttcctaggctggcagggtctgccg
ggccgcggtcgcgccctgggttcgggcgaagtgaagttcttcggtcaggtcctcccgacc
gcgaagaaaatcacctataacattcatatcaaacgcgtcctcaagggcaagctgaacatg
gccattgccgatggttcggtgactgtcgacggtcgcgaaatctacaccgccgagggcctt
cgggtcggcgttttcacctccactgacaacttctaa

DBGET integrated database retrieval system