KEGG   Pseudomonas corrugata: AXG94_08315
Entry
AXG94_08315       CDS       T04842                                 

Definition
(GenBank) histidine kinase
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
pcg  Pseudomonas corrugata
Pathway
pcg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pcg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AXG94_08315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcg01001]
    AXG94_08315
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pcg02022]
    AXG94_08315
Enzymes [BR:pcg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AXG94_08315
Protein kinases [BR:pcg01001]
 Histidine kinases
  OmpR family
   AXG94_08315
Two-component system [BR:pcg02022]
 OmpR family
  RstB-RstA
   AXG94_08315
SSDB
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_2 HATPase_c_3 DUF4381
Other DBs
NCBI-ProteinID: AOE61761
UniProt: A0A3M3EZ96
LinkDB
Position
complement(1990346..1991956)
AA seq 536 aa
MNSIFLRIYGGMCAALVLVAVLGVLALHLLNQTRSEQYRERLAHGTFSLMAENLQPMNDT
ERHRALLLWERLLGIPLALQTFAQTDLDLGQRTRVLRGQALVEQTGPHAAKVYRLVSDDE
QLMLVGEVQQISEQLARATIYLLADELVRYPVGEQPRRLAQLMEEKGFGFDLRLMTAEQA
DMDEDQRRRVSEGDTVMALGKGGDSIRVFAGMVGTPWVLEIGPLYQMNPYPPEWLVLIAA
LGLSLIGLIVYLLVRQLERRLSGLEAAATQIAQGSLETRVPARGADSVGRLAAAFNGMAE
HLQQLLAIQRELVRAVSHELRTPVARLRFGLEMIGSAATPQAREKYLAGMDHDIEDLDRL
VDEMLTYARLEQGSPALNFQRVDLDALVSQVIEELGPLRAGVTVERGLCLSAVDCDGAWV
EAEPRFLHRALQNLVGNAMRHAKSRVTVSYQVGQLRCRVDVEDDGPGVPEAAWERVFKPF
LRLDDSRARASGGHGLGLSIVRRIIYWHGGRALIAKSKSLGGACFSLSWPRHQDRG
NT seq 1611 nt   +upstreamnt  +downstreamnt
gtgaactcgatcttcctgcgcatttatggcggcatgtgcgcggcgctggtgctggtggcg
gtgctcggggtgctggctctgcacctgctcaaccagacccgtagcgagcagtaccgcgag
cgcctggcccacggcacgttttccttgatggccgagaacctgcagccgatgaacgacacc
gagcgccaccgggcgctgctgttgtgggagaggttgctgggcatccccctggcattgcag
accttcgcccagaccgacctggacctggggcagcgcacccgtgtgctgcgtgggcaggcc
ctggttgaacagaccgggccccatgcggcgaaggtctatcggctggtcagcgatgacgag
caactgatgttggtgggggaagtccagcagatcagcgagcagttggcccgcgcaaccatt
tacctgctggccgacgaactggtgcgctacccggtgggcgagcaaccccgacggctcgcg
cagctcatggaagaaaagggtttcggtttcgatctgcggttgatgaccgccgagcaggcg
gacatggacgaagaccagcgccgtcgcgtgtccgagggcgatacggtgatggccttgggc
aagggtggcgattcgatccgggtgttcgccgggatggtgggcacgccatgggtattggaa
atcggcccgctgtaccagatgaacccttacccgcccgaatggctggtcctgatcgcggcg
ttgggcttgagcctgatcgggttgatcgtctacctgttggtgcgtcaactggagcgacgc
ctgagcggcctggaggccgccgccacccagatcgcccagggcagcctggaaacccgcgtg
ccggcacggggcgccgactcggtcgggcggttggccgccgcattcaacggcatggccgag
cacctgcaacaactgttggcgatccagcgtgaattggtaagggcggtttcccacgaattg
cgaaccccggtggcgcgcctgcgcttcggcctggaaatgatcggcagcgctgccacgccc
caggctcgggaaaagtacctggcgggcatggaccatgacatcgaagacctggatcggctg
gtggacgagatgctcacctatgcgcgactggagcaaggctcaccggcgctgaacttccag
cgggtggatctggatgcgctggtcagccaggtgatcgaggagctgggcccgctgcgggcc
ggggtcacggtcgagcgtgggctgtgcctgtctgccgtcgattgtgacggcgcctgggtc
gaggccgagccacgcttcttgcatcgcgccttgcagaacctggtgggcaatgccatgcgc
catgccaagtcccgggtgaccgtcagctatcaggtgggacaactgcgttgccgggtggac
gtcgaggatgacgggcccggtgtgccggaggcggcctgggagcgggtgttcaagcccttc
ctgcgcctggacgacagccgtgcccgggcttcgggcggtcatgggttggggctgtcgatc
gtgcggcggatcatttactggcatggcggccgggcgttgatcgccaagagcaagagcctg
ggtggggcatgtttcagcttgagctggccgaggcatcaggacaggggttga

DBGET integrated database retrieval system