KEGG   Pseudomonas corrugata: AXG94_16130Help
Entry
AXG94_16130       CDS       T04842                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K14268  5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
pcg  Pseudomonas corrugata
Pathway
pcg00250  Alanine, aspartate and glutamate metabolism
pcg00310  Lysine degradation
pcg00650  Butanoate metabolism
pcg01100  Metabolic pathways
pcg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AXG94_16130
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AXG94_16130
   00310 Lysine degradation
    AXG94_16130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pcg01007]
    AXG94_16130
Enzymes [BR:pcg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AXG94_16130
    2.6.1.48  5-aminovalerate transaminase
     AXG94_16130
Amino acid related enzymes [BR:pcg01007]
 Aminotransferase (transaminase)
  Class III
   AXG94_16130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOE63223
LinkDB All DBs
Position
3711564..3712841
Genome map
AA seq 425 aa AA seqDB search
MSKTNADLMARRTAAVPRGVGQIHPIFAESAKNATVTDVEGREFIDFAGGIAVLNTGHVH
PKIIAAVTEQLNKLTHTCFQVLAYEPYVELCEKINAKVPGDFAKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALYPNELHGVS
IDDSIASIERIFKNDAEPRDIAAIIIEPVQGEGGFYVAPKEFMKRLRALCDQHGILLIAD
EVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPIACAAALAVMEVFEEEHLLDRCKAVGERLVNGLKAIQKKYPVIGEVRGLGAMIAVEL
FENGDSHKPNAAAVAQIVAKARDKGLILLSCGTYGNVLRVLVPLTSPDEQLDKGLAIIEE
CFSEL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagactaacgctgatctgatggcccgccgtaccgctgccgttccacgtggcgtc
ggccagattcacccgatcttcgctgaatcggcgaagaacgcaacggtaaccgacgttgaa
ggccgtgaattcatcgacttcgccggcggcatcgccgtactgaacaccggccacgtgcac
ccgaaaatcatcgccgccgtgaccgagcaactgaacaagctgacccacacctgcttccag
gtcctggcctacgagccgtacgtggaactgtgcgaaaaaatcaacgccaaggtccctggc
gatttcgccaagaaaaccctgctggtcaccaccggctccgaagcggtggaaaacgccgtg
aagatcgcccgtgccgccactggtcgtgcgggagtgattgctttcaccggcgcttaccac
ggtcgcaccatgatgaccctgggcctgactggcaaggtcgtgccgtactcggccggcatg
ggcctgatgccgggtggtatcttccgcgcgctgtacccgaacgaactgcacggcgtgagc
atcgacgattccatcgccagcatcgagcgcatcttcaagaacgacgccgagccgcgtgac
atcgctgcaatcatcatcgagccggtgcagggcgagggtggtttctatgtggcgccgaag
gagttcatgaagcgcttgcgtgccctgtgcgaccagcacggtattttgctgatcgccgac
gaagtgcagaccggcgcaggccgtaccggtaccttctttgccatggagcagatgggcgtt
gccgccgacctgactaccttcgccaaatccatcgctggcggcttcccgctggccggtgtc
tgcggcaaggccgagtacatggacgccatcgccccgggtggcctgggtggcacctatgcg
ggtagcccgatcgcttgcgcggcggcgctggcagtgatggaagtgttcgaagaagagcac
ctgctggatcgctgcaaggccgtgggcgagcgcctggtcaacggcctcaaggccatccag
aagaaatacccggtaatcggtgaagtccgcggcctgggcgcgatgattgccgtggagttg
ttcgaaaacggtgattcccataagccgaacgccgctgccgtggcccagatcgtggccaag
gcgcgcgacaagggtttgatcctgttgtcctgcggcacttatggcaacgtcctgcgtgtg
ctggtgccgttgacctcgccagacgaacagttggacaagggcctggcaatcatcgaagaa
tgcttctccgagctctga

DBGET integrated database retrieval system