KEGG   Pseudomonas corrugata: AXG94_16520Help
Entry
AXG94_16520       CDS       T04842                                 

Definition
(GenBank) cystine transporter subunit
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
pcg  Pseudomonas corrugata
Pathway
pcg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pcg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AXG94_16520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pcg02000]
    AXG94_16520
   02035 Bacterial motility proteins [BR:pcg02035]
    AXG94_16520
Transporters [BR:pcg02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    AXG94_16520
Bacterial motility proteins [BR:pcg02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    AXG94_16520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd
Motif
Other DBs
NCBI-ProteinID: AOE63295
UniProt: A0A3M3EJF8
LinkDB All DBs
Position
complement(3816392..3817192)
Genome map
AA seq 266 aa AA seqDB search
MNFSALRRNLLIGSLGLALSAGLLGQAVAGEQLQKIKDAGVINVGLEGTYPPFSFVDADG
KLAGFEVEFSEALAKELGVKVKLQATKWDGILAALESKRLDAVINQVTISEERKKKYDFS
QPYTVSGIQALVLKKNEEKLNIKAAADLAGKKVGVGLGTNYEQWLKDNVPKADIRTYEDD
PTKYQDLRIGRIDAILVDRLAAFELAKKAPDTAVAGDAFSRQEAGVTLRKGEPELLAAVN
QAIDKLRADGTLKKLSEKYFNADVTQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttctgcattacgtcgcaacctgttgatcggttcgctgggcctggcattgagc
gccggcctgctggggcaagcagtcgccggtgagcagctgcaaaaaatcaaggacgcaggc
gtgatcaacgtcggcctggaaggcacctatccaccgttcagcttcgtcgatgccgacggc
aaactggccggtttcgaagtagagttttccgaagccctggccaaagaactgggtgtaaag
gtgaagctgcaagccactaaatgggatggcatcctggctgcgctggagtccaagcgtctg
gacgccgtgatcaaccaggtcaccatttccgaagagcgcaagaagaagtacgacttctcc
cagccttacaccgtctccggtatccaggcgctggttctgaaaaagaacgaagaaaaactc
aatatcaaggccgccgccgacctggctggcaagaaagtcggtgtaggcctgggcaccaac
tacgaacaatggctcaaggacaacgtgcccaaggccgacatccgtacctacgaggatgat
ccgaccaagtaccaggacctgcgtatcggccgtatcgacgcaattctggtggaccgcctg
gccgcctttgaactggcgaagaaagccccggacaccgcggttgccggcgacgccttctcc
cgccaggaagccggtgtgaccttgcgcaaaggcgaacccgagctgctggcggcggtgaac
caagccattgataagctgcgcgccgacggcaccttgaagaagctgtccgagaaatacttc
aacgctgacgtcactcaataa

DBGET integrated database retrieval system