KEGG   Pseudomonas chlororaphis PA23: EY04_05070Help
Entry
EY04_05070        CDS       T03201                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pch  Pseudomonas chlororaphis PA23
Pathway
pch00620  Pyruvate metabolism
pch00680  Methane metabolism
pch01100  Metabolic pathways
pch01120  Microbial metabolism in diverse environments
pch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EY04_05070
  09102 Energy metabolism
   00680 Methane metabolism
    EY04_05070
Enzymes [BR:pch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EY04_05070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIC18277
UniProt: A0A2K9DHW1
LinkDB All DBs
Position
1160312..1162942
Genome map
AA seq 876 aa AA seqDB search
MTDIDARLREDVHLLGELLGNTIREQYGEGFLDKIEQIRKGAKADRRGSLDAELSASLNQ
LSEDELLPVARAFNQFLNLANIAEQYQLIHRREESQPAPFESRVLPELLARLRAEGHGAE
ALARQLGRLEIELVLTAHPTEVARRTLIQKYDAIAAQLAAQDHRDLTSAERAQIQTRLQR
LIAEAWHTEEIRRTRPTPVDEAKWGFAVIEHSLWQAIPNYLRKADQALHAATGMHLPLEA
APIRFASWMGGDRDGNPNVTAAVTREVLLLARWMAADLYLRDVDQLAADLSMQQANAALR
TLAGDSAEPYRAVLKQLRERLRATRNWAQASLSGSVPATAQVLQNNRELLDPLELCYASL
HECGMGVIADGPLLDCLRRAVTFGLFLVRLDVRQDSSRHTAAMTEITDYLGLGRYGDWSE
KERIDFLMRELGSRRPLLPGYFKPSADTAEVLATCREVAAAPAASLGSYVISMAGAASDV
LAVQLLLKEAGVLRPMRVVPLFETLADLDNAGPVIEQLLLLPGYRSRLQGPQEVMIGYSD
SAKDAGTTAAAWAQYRAQEKLVDICREQQVELLLFHGRGGTVGRGGGPAHAAILSQPPGS
VAGRFRTTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLLPPPLPQPAWRDLMDELADD
GVKAYRAVVRENPQFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIFGWTQT
RLMLPAWLGWETALSKALERGEGELLGQMREQWPFFRTRIDMLEMVLAKADADIARSYDE
RLVEPALLPLGAHLRDLLSQACSVVLGLTGQSQLLAHSPDTLEFIRLRNTYLDPLHLLQA
ELLARSRRQDGAQDSPVEQALLVSVAGIAAGLRNTG
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattgatgcgcgcttgcgcgaagatgttcacctgctgggtgagctgttgggc
aacaccattcgtgaacagtatggcgagggtttcctcgacaagatcgaacagattcgcaag
ggcgccaaggccgaccggcgcggttcgctggatgccgaactcagcgccagcctcaaccag
ctcagcgaggacgaattgctgccggtggcgcgggcgttcaaccagtttcttaacctggcc
aacatcgccgagcagtaccagttgattcaccgtcgcgaggagtcgcagccggcgccgttc
gagtcgcgggtgctgccggaactgctggcgcgcctgcgggccgaaggccatggcgccgag
gcgctggcccggcaattggggcgtctggaaatcgaactggtgctgaccgcccaccccacc
gaagtcgcgcgccgcacgctgatccagaaatacgatgccatcgccgcgcaactggccgcc
caggaccatcgcgacctgacctcggccgaacgcgcgcagatccagacccgcctgcagagg
ctgatcgccgaggcctggcacaccgaagaaatccgccgtacccggccgaccccggtggac
gaagccaagtggggcttcgcggtgatcgaacattcgctgtggcaggccatccccaattat
ttgcgcaaggccgaccaggccctgcatgcggccaccggcatgcacttgccgctggaggcg
gcgccgatccgcttcgcttcgtggatgggcggcgaccgtgacggcaaccccaatgtcacc
gcggcggtgacccgcgaggtgctgttgctggcgcgctggatggccgccgacctgtacctg
cgcgatgtcgatcaactggctgccgacctgtccatgcagcaggccaacgcggcgctgcgg
accctggccggcgacagcgccgaaccctatcgcgcggtgctcaagcaactgcgcgagcgc
ctgcgggccacccgcaactgggcccaggcctcgttgagcggtagcgtgccggcgacagcc
caggtcttgcagaacaaccgcgagctgctggacccgctggagctctgctacgcgtccctg
cacgaatgcggcatgggcgtgatcgctgatggaccgttgctcgactgcctgcgccgcgcg
gtgaccttcggcctgttcctggtgcgcctggacgtgcgtcaggactcctcgcggcacacc
gcggccatgaccgaaatcaccgattacctggggctgggccgctacggcgactggagcgag
aaagagcgcatcgatttcctgatgcgcgaactgggcagccgccgtccgctgctgcccggt
tacttcaagccatcggccgataccgccgaagtgctggcgacctgccgggaagtcgccgcg
gccccggcggcttcgctgggttcctatgtcatctccatggccggcgcggcttccgatgtg
ctcgccgtgcaactgctgctcaaggaagcgggcgtgctgcggccgatgcgcgtggtgccg
ctgttcgaaaccctggctgacctggataacgccggcccggtgatcgagcaactgctgctt
ctgccgggttatcgctcgcgcctgcaggggccgcaggaagtgatgatcggttattccgac
tcggccaaggatgccggcaccaccgctgccgcctgggcgcagtaccgggctcaggaaaaa
ctggtggatatctgccgcgagcagcaggtcgagctgctgctgttccacggtcgcggtggc
accgtggggcgtggcggcggcccggcccacgcggcgatcctgtcgcagccgccgggatcg
gtggcggggcgcttccgcaccaccgagcaaggggaaatgattcgtttcaaattcggcctg
ccggacatcgccgagcagaacctcaatctctacctggcggcggtgctggaagcgaccttg
ttgccaccgccgctgccgcagccggcctggcgcgacctgatggacgagttggccgacgac
ggggtgaaggcctatcgcgcggtggtgcgggagaacccgcagttcgtcgagtatttccgc
cagtccacaccggagcaggaactggggcgcctgccgctgggtagccggccggccaagcgc
cgcgccggcggcatcgaaagtctgcgggccatcccgtggattttcggctggacccagacg
cgcctgatgctgccggcctggctgggctgggaaaccgccttgagcaaggccctggaacgc
ggggaaggcgagttgctggggcagatgcgcgaacagtggccgtttttccgcacgcgcatc
gacatgctggagatggtgctggccaaggccgacgcggatatcgcccgttcctacgacgag
cgattggtcgaaccggcgctgctgccattgggtgcgcatttacgcgacttattgtcgcag
gcgtgttcggtggtcttggggctgaccggtcagtcgcagttactggcacatagccctgac
accctggagttcattcgcctgcgcaatacctacctggacccgctgcatctattgcaggcc
gaactgctggcccgttcgcggcgccaggacggcgcgcaggacagcccggtggaacaggcg
ctgctggtgtctgtggcggggattgccgccggtttgcgtaataccggctaa

DBGET integrated database retrieval system