KEGG   Pseudomonas chlororaphis PA23: EY04_16685Help
Entry
EY04_16685        CDS       T03201                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
pch  Pseudomonas chlororaphis PA23
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 AraC_binding_2 HTH_AraC AraC_binding HTH_23
Motif
Other DBs
NCBI-ProteinID: AIC20484
LinkDB All DBs
Position
complement(3716806..3717768)
Genome map
AA seq 320 aa AA seqDB search
MSPCALLETRHACTQDIALDQRLAFWEDYNASTLVGLKCSSFCESGFAASQDNLQLEGMR
LAQIEGNEHVVERDNSMIRSVPKESVFVSFVTGSGSFFYQDGACQLLEPGELIVYRTDKP
YLFGFSGPMRQFIFDIPQALFAERCLKRFDRPLKIGGQSGVQRLLLRTLGERTRGFFQQP
LSQDAGGYQDQALELLGSLIAGQVGERRINALSASYLLAAKQCINEQLADPELSCERVAA
QTGISPRHLSRLFALEGTQPSRFILEKRLQQAHDLLGSPRGTGLDIGEIAYRHGFTSQAH
FARAFKAHYGQTPSEVRASL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtctccatgcgccttgctcgaaacccggcatgcctgcacccaggacatcgccctggat
cagcggctggccttctgggaggactacaacgcctccaccctggtcggcctcaaatgcagc
tctttttgtgaaagcggttttgccgccagccaggacaacctgcaactggagggcatgcgc
ctggcgcagatcgagggcaacgagcacgtggtcgagcgtgacaactcgatgatccgctcg
gtgcccaaggaatcggtgttcgtgtccttcgtcaccggcagcggctcgtttttctatcag
gacggtgcctgtcagttgctcgaaccgggcgagctgatcgtctaccgcaccgacaaaccc
tatctgttcgggttctccgggccgatgcgccagttcattttcgacattccccaggcgctg
ttcgccgagcgctgcctcaagcgtttcgaccgtccgctgaagattggcgggcaaagcggc
gtgcagcgcctgttgctgcgcaccctgggcgaacgcacccgcggctttttccagcagccc
ctgagccaggacgccggcggttatcaggaccaggcgctggagctgctgggcagcctgatc
gccgggcaggtgggcgagcggcggatcaatgcgctgagcgcctcctacctgctggcggcc
aagcagtgcatcaacgaacagttggccgacccggagctgagctgcgagcgggtggccgcg
caaaccggcatttcaccgcggcacctgagccggctgttcgccctggaaggcacccagccc
agccgctttatcctggaaaaacgcctgcagcaggcccatgacctgctgggcagcccgcgg
ggaacaggcctggatatcggcgaaatcgcctaccgccacggcttcaccagccaggcccac
ttcgcccgggcgttcaaggcccattacggccagaccccaagcgaagtgcgcgcgtccctg
tag

DBGET integrated database retrieval system