KEGG   Pseudomonas chlororaphis PA23: EY04_16690Help
Entry
EY04_16690        CDS       T03201                                 

Definition
(GenBank) 2,4-dihydroxyacetophenone dioxygenase
  KO
K05913  2,4'-dihydroxyacetophenone dioxygenase [EC:1.13.11.41]
Organism
pch  Pseudomonas chlororaphis PA23
Pathway
pch01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pch00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00363 Bisphenol degradation
    EY04_16690
Enzymes [BR:pch01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.41  2,4'-dihydroxyacetophenone dioxygenase
     EY04_16690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7
Motif
Other DBs
NCBI-ProteinID: AIC20485
UniProt: A0A0E1E5I4
LinkDB All DBs
Position
3718054..3718587
Genome map
AA seq 177 aa AA seqDB search
MPEAASREFWKDLQPIANCFKPDAKPEVYLANAASDDLKLYVPFTETVSSRPLWISPSEN
RWCDILMASSAGLVNRHYHPHEVFAYTLSGKWGYLEHDWTATAGDFVYETPGEGHTLVAY
EHEQPMRAFFIVKGPLIWLDEQGEPEGYFDVHSYIAMCRAHYEKIGLGAAYIDTLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagccgccagccgtgaattctggaaagacctgcaaccgatcgccaattgcttc
aagccggacgccaagcccgaggtctacctggccaatgccgccagcgacgacctgaagctc
tatgtgcccttcaccgaaaccgtgtcctcgcggccgctgtggatctcgccgagcgagaac
cgctggtgcgacatcctcatggccagcagcgccgggctggtgaaccggcattaccacccc
cacgaagtgttcgcctacaccctgtccggcaagtggggctacctggagcacgactggacc
gccaccgccggcgacttcgtctacgagaccccgggcgaaggccacaccctggtggcctac
gagcacgaacagccgatgcgcgcgtttttcatcgtcaagggcccgctgatctggctcgac
gaacagggcgagccggagggttatttcgacgtgcactcctatatcgccatgtgccgcgcg
cactacgaaaagatcggcctcggcgcggcctatatcgacacgctgtttcgctga

DBGET integrated database retrieval system