KEGG   Pseudomonas chlororaphis PA23: EY04_16860Help
Entry
EY04_16860        CDS       T03201                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pch  Pseudomonas chlororaphis PA23
Brite
KEGG Orthology (KO) [BR:pch00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EY04_16860
Enzymes [BR:pch01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EY04_16860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored AlaDh_PNT_C FAD_binding_3 K_oxygenase Thi4 Glutaredoxin FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIC20517
UniProt: A0A0E1EAV5
LinkDB All DBs
Position
complement(3753214..3754779)
Genome map
AA seq 521 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLELLKDVASLSSQITLLDNGNDAR
KPSFSINRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRALKGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVNDRKIMAVPSVYLNGVNF
GQGRMGLEEILGKLDTGAIEKQAEKISAKDAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFVSVQETEGPKLASALEEHVRQYDVDIMNLQRASALVPAKEVGG
LHEVRFESGASLKAKSLILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQRKLYSLANVKVITSALTSEVKGDG
QKVTGLVYKDRDSGEFNTVDLEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDARGETSLP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaagtcatacctggaacgggtcacccagccg
atcgagatcgttgcctctctcgacgacggtgcgaaatcccaggaaatgctcgaattgctg
aaagacgttgccagtctttccagccagattaccttgctcgacaacggtaacgatgcacgt
aaaccatcgttctcgatcaatcggccgggtgccgacatcagcctgcgtttcgccggcatt
cccatgggccacgaattcacttccctggtgctggccttgctgcaagtcggcggccacccc
tcgaaagccagtgtcgaagtgatcgaacagatccgcgccctcaaaggcgagttcaacttc
gagacttacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggcggtgctgaacccgaacatccgccacgtcgccatcgacggcgcgttgttccaggac
gaagtcaacgatcgcaagatcatggcggttcccagtgtctacctcaatggcgtgaacttc
ggccagggccgcatgggcctggaagaaatcctcggcaagctcgacactggcgccatcgag
aagcaggcggaaaaaatcagcgccaaggacgccttcgatgtcctggtggtcggcggtggc
ccggccggtgcgtcggcggcgatctacgcggcccgcaaaggcatccgcaccggtgtcgcg
gccgagcgtttcggcggccaggtgctggacaccatggccatcgagaacttcgtctcggtc
caggaaaccgaagggccgaaactggccagcgccctggaagagcacgttcgtcagtacgac
gtcgacatcatgaacctgcagcgcgccagcgcgctggtgccggccaaggaagtcggcggc
ctgcacgaagtgcgtttcgaaagcggcgcgagcctcaaggccaagtcgctgatcctggcc
accggtgcccgctggcgcgagatgggggtgcccggcgagcaggaatacaaggccaagggc
gtgtgcttctgcccgcactgcgacggtccgctgttcaagggcaagcgtgtggcggtgatc
ggtggtggtaactccggcgtcgaagcggccatcgacctggcgggtatcgtcagccacgtg
accctgctggagttcgacagcaagctgcgcgccgacgccgtgttgcaacgcaagctgtac
agcctggcgaacgtcaaggtaatcaccagcgcgctgaccagcgaagtcaagggtgacggc
cagaaagtcaccggcctggtgtacaaggaccgcgattcgggcgagttcaacaccgtcgac
ctggaagggatcttcgtgcagatcggtctgctgccgaacaccgactggctcaagggcact
gtcgagctgtcgccccgtggcgagatcattgtcgatgcccgtggcgagacttcgctgccc
ggcgtgtttgccgccggtgacgtgaccaccgtgccgtacaagcagatcgtgatcgcggta
ggcgagggcgccaaggcctcgctgagtgccttcgaccacctgatccgcacctccgcgccg
gcctga

DBGET integrated database retrieval system