KEGG   Pseudomonas chlororaphis PA23: EY04_18205Help
Entry
EY04_18205        CDS       T03201                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
pch  Pseudomonas chlororaphis PA23
Pathway
pch02025  Biofilm formation - Pseudomonas aeruginosa
pch03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EY04_18205
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    EY04_18205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pch01001]
    EY04_18205
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pch02044]
    EY04_18205
Enzymes [BR:pch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EY04_18205
Protein kinases [BR:pch01001]
 Serine/threonine kinases: Other
  Bacterial family
   EY04_18205
Secretion system [BR:pch02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   EY04_18205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH VWA_2 VWA Pkinase_fungal TssR Kinase-like VWA_CoxE
Motif
Other DBs
NCBI-ProteinID: AIC20766
LinkDB All DBs
Position
complement(4007745..4010822)
Genome map
AA seq 1025 aa AA seqDB search
MDIPGYAIERELGEGAMATVYLATQRSLERKVALKVMAAALAADRSFCERFLREGKTLAR
LSHPHTVTIYDIGNVGHFYYMAMEYLPNGTLKERIAEGLSPQQGLVYLRQIALALGYAHA
QGLVHRDVKPANILFRANGSAVLSDFGIAKSLEDHTQFTQAGFAVGTPSYMSPEQARGQQ
IDGRTDLYALGVVLYEILTGKLPYIGSDSLSTALAHLTEPLPELPIAHGRYQGILRKLLA
KDPAERFADADALIAALDHLPPAGPADAEATQLRPLPLPATASAAGQSATTDLGGLAPVS
LDMPPLAVPKPAPEPAPQPAATATATRAASLGAEPPAGSRRPLWALFGVVVAGVLALAGG
GYWWLRSPPVEPQNDQVEAKKTPAGDAQDSPAKTASAAQPPLATNADGGDRPLLMPGKKT
LFQRVLSKPGAQVSGQPGAAPDGAALPAFSVLYVYQRKAVAGGSWLEVGAASDGQRDGWL
PAEQVSDWKQSLVLKFTERSGRSPVMFLREESSLERFLADTAQARAALHKAQNEGSVDPQ
IVALEPVASAIPQDQFYLLPIFQARESFDANGQPVQLLNVASIDPGNTPQGKAEGAARAG
GDAFRTAIVLVVDTSVSMQPYIDRVRKVVQALHQQIASRGDLDSVSFGLVGFRSNVEKTP
GLEYVAQTLVSLEEGRDPQRFLELAGQVKAAQVSSHAFNEDAFAGVMAAVEGTDWSPYAG
RLILLVTDAGALRKNDPLGRTQMNEAEVREAALSKQVKIYALHLRTEAGRKNHGFAEQQY
RSLTADANPQIGDLYIPVAGGDVGRFGDTVAEIGSVFAEQVHQARNNQLPSLPPLQGAAS
VASKATAIGYAMQMDFLGRQSAVRAPQLITAWTSDHDLTNPSLPAFQVCVLLTKLQLNDL
QQSLKLIVDAARRTQTSPKDFFQEIASASAHMSRDPTRLKQGGNLVEGGILGEYLDGLPY
RSKSLSMTQDLWLSLSVAEQQDFIDELESKIRLYETFHNDIANWVRFGEAQPGDALYRVP
LATLP
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atggacattcccggctatgcgatcgagcgcgagctgggcgagggcgccatggccacggtc
tacctggcgacccagcgctcgctggagcgcaaggtggcgctcaaggtcatggccgccgcg
ctggccgccgaccgcagcttctgtgagcgcttcctgcgcgagggcaagaccctggcgcgg
ctctcccacccgcacacagtgaccatctacgacatcggcaatgtcggccacttctactac
atggccatggagtacctgccgaacgggacgctcaaggagcggattgccgaggggctcagc
ccgcagcagggcctggtctacctgcgccagatcgccctggccctggggtatgcccatgcc
cagggcctggtgcaccgggacgtcaagccggccaatatcctgtttcgcgccaacggttcg
gcggtgctctcggacttcggcatcgccaagtccctggaagaccacacccagttcacccag
gccggtttcgccgtgggcacacccagctacatgagccctgaacaggctcgcggccagcag
atcgacgggcgcaccgacctctacgccctgggggtggtgctctacgagatactcaccggc
aagctgccctatatcggcagcgactcgctgtccacggccctggcccacttgaccgagccg
ctgcccgaactgcccatcgcccacggccgttaccaggggatcctgcgcaagctgctggcc
aaggacccggccgagcgctttgccgatgccgatgcgctgatcgccgcgctggaccatctg
ccgcccgccgggccggccgatgccgaggcgacgcagttgcgcccattgccgttgccggcc
accgcgtcggcggccggccaatccgcgacgaccgacctgggcgggctggcgccggtttcc
ctcgacatgccgccgctcgctgtgccaaagcccgcgcctgaacccgcaccccagccagcc
gccacggccacagccacccgggccgcaagcctcggcgcagagccgccggccgggtcgcgt
agaccgttatgggcactgttcggtgtggttgtggccggggtactggccctggctggcggg
ggctactggtggctgcgctcgccgccggtggaaccgcaaaacgaccaggtcgaggccaaa
aaaacgccggctggcgatgcgcaggactcgcccgccaagacggccagcgcagcgcaaccg
ccgctggcgacgaacgccgatggcggcgaccgtccgctgctgatgccgggcaagaaaacc
ctgttccagcgggtgctgagcaagcccggcgcacaggtgtccggccagcccggggcggcg
cccgacggtgcggcgctgccggcgttctcggtgctgtatgtctatcagcgcaaggcggtg
gcgggtggcagctggctggaggtcggcgccgccagcgatggccagcgcgatggctggttg
ccggccgagcaggtcagcgactggaagcagagcctggtgctgaagttcaccgagcgctcc
ggtcgttcgccggtcatgttcctgcgcgaggagagcagcctcgaacggttcctggctgac
acggcgcaggcccgcgcggccctgcacaaggcgcagaacgaaggcagcgtggacccgcag
atcgtcgcgctggagcctgtggccagtgccatcccccaggaccagttctacctgctgccg
attttccaggcccgagagagtttcgatgccaacggccagccggtgcaactgctcaacgtg
gcctccatcgaccccggcaatacgccccagggcaaggccgagggggcggccagggccggc
ggcgatgccttccgcacggcgatagtgctggtggtcgacacctcggtgtcgatgcagccc
tacatcgaccgggtgcgtaaggtcgtgcaggcactgcaccagcagatcgccagccgtggc
gacctggacagcgtcagcttcggcctggtggggtttcgcagcaatgtcgagaagaccccg
ggcctggaatatgtggcgcaaaccctggtgagcctggaggagggtcgcgatccacaacgc
ttcctcgagctggctggccaggtcaaggccgcccaggtgtccagccacgccttcaatgag
gatgccttcgccggtgtgatggcggcggtcgagggtacggactggagcccctatgccggg
cggctgatcctgctggtcaccgacgcaggcgccctgcgcaagaacgatccgctggggcgc
acccagatgaacgaagccgaggtgcgcgaagccgccctcagcaaacaggtcaagatctat
gcgctgcacttgcgcaccgaggccggccggaaaaaccacggcttcgccgagcagcagtac
cgcagcctgacggccgacgccaacccgcagatcggcgacctgtacattccggtggcgggc
ggcgatgtcggtcgcttcggcgatacggtcgccgagatcggctcggtattcgccgaacag
gtgcatcaggcgcgcaacaaccagctgccgagcctgccgccgctacagggggccgcgagc
gtcgcgagcaaggccacggccatcggctacgccatgcaaatggactttctcggccgccag
tcggcggtccgtgcgccgcagctgatcaccgcctggacctccgaccatgacctgaccaac
ccctcgctgccggccttccaggtctgcgtgctgctgaccaagctgcagctcaacgacctg
cagcagtcgctgaaactgatcgtcgatgcggcccgccgtactcagacctcgcccaaggat
ttcttccaggaaatcgccagcgccagcgcccacatgagccgcgacccgacgcggttgaag
cagggcggcaacctggtcgaaggcggcatcctcggcgagtacctggacggcctgccgtat
cgcagcaaatcgctgagcatgacccaggacctctggctgtccctgagcgtggccgagcag
caggacttcatcgacgaactggagtcgaagatccgcctgtacgagaccttccacaacgac
attgccaactgggtccgcttcggcgaggcccaaccgggcgatgcgctgtaccgcgtgccc
ctggcgacgctgccctga

DBGET integrated database retrieval system