KEGG   Pseudomonas chlororaphis PA23: EY04_21465Help
Entry
EY04_21465        CDS       T03201                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pch  Pseudomonas chlororaphis PA23
Pathway
pch00220  Arginine biosynthesis
pch00250  Alanine, aspartate and glutamate metabolism
pch00290  Valine, leucine and isoleucine biosynthesis
pch01100  Metabolic pathways
pch01110  Biosynthesis of secondary metabolites
pch01130  Biosynthesis of antibiotics
pch01210  2-Oxocarboxylic acid metabolism
pch01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pch00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EY04_21465
   00290 Valine, leucine and isoleucine biosynthesis
    EY04_21465
   00220 Arginine biosynthesis
    EY04_21465
Enzymes [BR:pch01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     EY04_21465
    2.6.1.66  valine---pyruvate transaminase
     EY04_21465
Amino acid related enzymes [BR:pch01007]
 Aminotransferase (transaminase)
  Class I
   EY04_21465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIC21383
UniProt: A0A0E1E8C4
LinkDB All DBs
Position
4783438..4784649
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMAMQALLNNGDE
VLVPAPDYPLWTAAVSLAGGNPVHYLCDEQANWWPDIADIKAKITPNTKALVIINPNNPT
GAVYPKEVLLEMLELARQHNLVVFSDEIYDKILYDDAVHVCTASLAPDLLCLTFNGLSKS
YRVAGFRSGWVAISGPKHHAQSYIEGIDMLANMRLCANVPSQHAIQTALGGYQSINDLVL
PPGRLLEQRNRTWELLNDIPGVSCVKPMGALYAFPKIDPKVCPIHNDEKFVLDLLLSEKL
LVVQGTAFNWPWPDHFRVVTLPRVDDLEQAIGRIGSFLKSYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaacgtctgttatgacattcgcggcccagtg
ctcaagcacgccaaacgcctggaagaggaaggccatcgcatcctcaagctgaacatcggc
aacccggcgccttttggtttcgaagcgccggacgaaattctccaggacgtgatccgcaac
ctgccgaccgcacagggctacagcgactccaagggcctgttcagcgcccgcaaggcagtc
atgcagtactaccagcaaaagcaggtggaaggcgtcggcatcgaagacatctacctgggc
aacggcgtttccgaactgatcgtcatggccatgcaggccctgctcaacaacggtgacgaa
gtgctggtaccggctccggactacccgctgtggaccgcggccgtgagcctggccggcggc
aacccggtgcactacctgtgcgacgagcaggccaactggtggccggacatcgccgacatc
aaggccaagatcaccccgaacaccaaggccctggtgatcatcaacccgaacaacccgacc
ggcgcggtataccccaaggaagtgttgctggagatgctcgaactggcgcgccagcacaac
ctggtggtgttctccgacgagatctacgacaagatcctctacgatgacgccgtgcacgtc
tgcactgcctccctggcgccggacctgctgtgcctgaccttcaacggcctgtccaagtcc
taccgggtggccggtttccgttccggctgggtggccatttccggtcccaagcaccacgcc
cagagctacatcgaaggcatcgacatgctggccaacatgcgcctgtgcgccaacgtgccg
agccagcacgccatccaaaccgcgctgggcggctaccagagcatcaacgacctggtgctg
ccgccgggccgcctgctggaacagcgcaaccgcacctgggaactgctcaacgacatcccc
ggcgtcagctgcgtcaagcccatgggcgcgctgtacgccttcccgaaaatcgacccgaaa
gtctgcccgatccacaacgatgagaagttcgtcctggacctgctgctctcggagaaactg
ttggtggttcagggcaccgccttcaactggccatggccggaccacttccgtgtcgtgaca
ttgccgcgggtcgatgacctggaacaggcgatcggccgtatcggcagcttcctcaagtcg
tatcgccagtaa

DBGET integrated database retrieval system