KEGG   Pseudomonas chlororaphis PA23: EY04_23640Help
Entry
EY04_23640        CDS       T03201                                 

Definition
(GenBank) aldose epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pch  Pseudomonas chlororaphis PA23
Pathway
pch00010  Glycolysis / Gluconeogenesis
pch00052  Galactose metabolism
pch01100  Metabolic pathways
pch01110  Biosynthesis of secondary metabolites
pch01120  Microbial metabolism in diverse environments
pch01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EY04_23640
   00052 Galactose metabolism
    EY04_23640
Enzymes [BR:pch01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     EY04_23640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AIC21800
UniProt: A0A2K9DZ05
LinkDB All DBs
Position
5225571..5226719
Genome map
AA seq 382 aa AA seqDB search
MPHSPYRLSGLGLSLLLASLGAQAAGLSSEHKAFGTTLDGSAVEQYVLRNSHGLQATVIT
YGAVLQSLKVPDKNGAFDDVVLGFDDVQGYQRGTAFFGATIGRYGNRLAGGAFELDGQRY
QVPLNDGPNSLHGGAQGFDKRVWKARPIKRKDAVGVTLSYLSKDGEMGFPGNLQVEVTYS
LNDNNELRIEYSASTDKPTVLNLTNHSYFNLAGAGNGDVLAQLATLHASHYTPVNAKLIP
TGELAPVAGTPLDFRQPTAIGQHIKDDHPQLKFAEPKQGGFDFNWVLDAKGDVGQLAAEV
RDPQSGRRLQLYTSEPGVQFYTSNFLDGTLKGKAGKTYSHWGAFTLETQHFPDSPNQPDF
PSTRLNPGQVYSQDTVLKFSAD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgccgcactccccctaccggctttccggcctcggcctgtcgctgctgcttgccagcctc
ggcgcccaggccgcgggcctgtccagcgaacacaaagcctttggcacgaccctcgacggt
agcgctgtcgagcaatatgtgttgcgcaacagccatggcctgcaagccacggtcatcacc
tatggcgcggtcctgcaatcgttgaaggtgccggataagaacggcgccttcgacgacgtg
gtcctgggcttcgacgacgtccagggctatcagcgcggcaccgcgttcttcggcgccacc
atcggccgctacggcaatcgcctggccggcggggcgttcgagctggacggccagcgttac
caggtgcccctcaacgacggcccgaattcgctgcatggcggcgcccagggcttcgacaag
cgcgtctggaaggcccggccgatcaagcgcaaggacgctgtcggggtgaccttgagctac
ctgtccaaagacggcgaaatgggctttcccggcaacctgcaggtcgaggtcacctacagc
ctcaacgacaacaacgagctgcgcatcgagtacagcgcctccaccgacaaacccacggtg
ctgaacctcaccaaccacagttacttcaacctcgccggcgccggtaacggcgatgtgctc
gcccagctcgccaccttgcacgccagccactacacgccggtcaacgccaagctgattccg
accggtgaactggccccggtcgccggcacgccgctggacttccggcaaccgaccgccatc
ggccagcacatcaaggacgatcatccgcagctcaagttcgccgagccgaaacagggtggc
ttcgacttcaactgggtgctcgacgccaagggcgacgtcggccagctcgccgccgaggtg
cgcgacccgcaatccggtcgtcgcttgcagctctacaccagcgaacccggggtgcagttc
tacaccagcaacttcctcgacggcacgctcaagggcaaggcgggcaagacctacagccac
tggggcgcgttcaccctggagacccagcacttccccgactcgcccaaccagccggacttc
cccagcacccggctgaaccccggccaggtctacagccaggacaccgtcctgaagttctcc
gccgactga

DBGET integrated database retrieval system