KEGG   Pseudomonas chlororaphis PA23: EY04_25020Help
Entry
EY04_25020        CDS       T03201                                 

Definition
(GenBank) PadR family transcriptional regulator
Organism
pch  Pseudomonas chlororaphis PA23
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PadR CbtB DUF505 RTP
Motif
Other DBs
NCBI-ProteinID: AIC22057
LinkDB All DBs
Position
5516455..5517030
Genome map
AA seq 191 aa AA seqDB search
MREHHHPHREYGDGHDGFEKRPGRERGGRGPRVFAPGDLKLLLLALIAEQPCHGYDLIRQ
IEGMFDGAYSPSPGVIYPTLTFLEESELISGDAEGGKKRYSVTEAGRLSLQDQAIALDGV
RMRIDVSKRSLRGHDRPAEIHEAVHNLRHALQMHHGRWNPQEIVRVRDLLNNTARAIVDG
PAPPSTQESAE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagagaacaccaccatccccaccgcgagtacggcgacggccacgacggtttcgagaaa
cgccccgggcgcgaacgcggcggccgcggcccgcgggtcttcgcccccggcgacctgaag
ctactgttgctggcgttgatcgccgagcagccatgccacggctatgacctgatccgccag
atcgaaggcatgttcgatggcgcctacagccccagcccgggcgtgatctacccgaccctg
accttcctcgaagaaagcgaactgatcagcggcgatgccgaaggcgggaaaaaacgctac
agcgtgaccgaggccggtcgtctgtcattacaggaccaggcgattgccctggacggcgtg
cgcatgcgcatcgacgtcagcaaacgctcgctgcgcggccatgatcgcccggcggaaatc
cacgaggcggtgcataacctgcgccacgccctgcagatgcaccacggccgctggaacccg
caagaaatcgtgcgggtccgcgacctgctgaacaacaccgcccgcgccatcgtcgacggc
ccggcccccccttctacccaggagtcagctgaatga

DBGET integrated database retrieval system