KEGG   Pseudomonas chlororaphis PA23: EY04_25645Help
Entry
EY04_25645        CDS       T03201                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pch  Pseudomonas chlororaphis PA23
Pathway
pch00473  D-Alanine metabolism
pch00550  Peptidoglycan biosynthesis
pch01100  Metabolic pathways
pch01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pch00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    EY04_25645
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EY04_25645
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    EY04_25645
Enzymes [BR:pch01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EY04_25645
Peptidoglycan biosynthesis and degradation proteins [BR:pch01011]
 Precursor biosynthesis
  Amino acid ligase
   EY04_25645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_Ter RimK ATPgrasp_YheCD ATP-grasp_5 GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AIC22180
UniProt: A0A2K9EH63
LinkDB All DBs
Position
complement(5653095..5654063)
Genome map
AA seq 322 aa AA seqDB search
MTAAYASLFSTIAPKDFGRVAVLFGGKSAEREVSLKSGNAVLEALLSAGVDAFGIDVGDD
FLQRLLNEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHAVLGSEADCICAATELGMPLIVKPAHEGSSIGMAKVTSASELIDAWKAAST
YDSQVLVEQWIQGPEFTIATLRGQVLPPIALGTPHTFYDYDAKYLASDTQYRIPCGLDSD
KEQELMDLTAKACGALGIAGWARADVMQDADGQFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAESVVSNAEPRG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgcctacgcctctctgttttcgaccatcgcgccgaaggatttcggccgtgtc
gccgtgctgttcggcggcaagagcgccgagcgcgaagtctcgctgaagtccggcaatgcc
gtgcttgaagccttgctgagcgccggtgtggacgccttcggcatcgacgtcggtgacgac
ttcttgcagcgcctgctgaacgagaagatcgaccgcgccttcatcatcctccacggccgt
ggcggcgaagacggcagcatgcagggcttgctggaatgcctggggattccctacaccggc
agcggcatcctggcttcggcgctggcgatggacaaactgcgtaccaagcaggtctggcac
agcctcggtattccgacgccacgccacgccgtacttggctccgaggccgattgtatttgc
gcggctacggaactgggcatgcctttgatcgtcaaaccggcgcatgaaggttccagtatt
ggtatggccaaagtgacatccgcgtccgaactgatcgacgcatggaaagcggccagcacc
tacgactcgcaagtcttggttgaacaatggattcaaggtccggagttcaccatcgccacg
ctgcgcggccaggtattgccaccgatcgccctgggcacgccccacacgttttacgactac
gacgccaagtacctggcttccgatacccagtaccggatcccgtgcggcctcgacagcgac
aaagagcaggagctcatggacctgacggcgaaggcctgcggggcgctcggtatcgccggt
tgggcgcgtgccgacgtgatgcaggacgccgacggccagttctggttcctggaagtgaat
accgcccccggcatgaccgatcacagcctggttccgatggcggcgcgtgccgccggtctg
gatttccagcagctggttctggccatcctggcggaaagtgtcgtcagtaacgcagagccg
cgaggttaa

DBGET integrated database retrieval system