KEGG   Pseudomonas chlororaphis PA23: EY04_31170Help
Entry
EY04_31170        CDS       T03201                                 

Definition
(GenBank) membrane protein
  KO
K07090  uncharacterized protein
Organism
pch  Pseudomonas chlororaphis PA23
Brite
KEGG Orthology (KO) [BR:pch00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    EY04_31170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE UPF0016
Motif
Other DBs
NCBI-ProteinID: AIC23216
LinkDB All DBs
Position
6822164..6822946
Genome map
AA seq 260 aa AA seqDB search
MEFLLYLLLGACAGVLAGLFGVGGGIIIVPVLVFSFTLQGFDPSILTHLAVGTSLATIIF
TSVNAVREHQRRGAVRWPIFAWMTLGILLGAGVGALTAEAISGPNLQKIIGVFALVIALQ
MTLDLRPKASRDVPGKLGLTLAGSVIGWASAIFGIGGGSLTVPFLTWRSVPMQQAVATSS
ACGLPIAVASAISFMILGWHDPSLPAHSLGFVYLPALLGIALTSMVFARFGARLAHRLSP
RLLKRLFAGLLFVVGLTFLL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggaatttctgctctatctgctgctgggggcctgcgccggcgtattggctggtctgttt
ggcgtgggtggcggcatcatcatcgtgcccgtgctggtgttcagcttcaccttgcaaggt
ttcgatccgtcgatcctgacccacctggcggtcggcacgtcgctggcgaccatcatcttc
acctcggtcaacgcggttcgcgaacaccagcgcaggggcgcggtgcgctggccgatcttt
gcctggatgaccctgggcatcctgctcggcgccggggtcggggcgctgacggccgaagcg
atctccgggccgaacctgcagaaaatcatcggtgtcttcgccctggtgatcgccctgcag
atgaccctggatctgcggcccaaggccagccgcgacgttcccggcaagctcgggctgacc
ctggccggcagtgtgatcggctgggcttcggcgattttcggcatcggcggcggctcgctg
accgtgccgttcctgacctggcgcagcgtgccgatgcagcaggcggtggccacgtcctcg
gcctgtggtttgccgattgccgtggccagtgcaataagtttcatgattctgggctggcat
gatccgtcgctgccggctcatagtctgggttttgtgtatttgccggcgctgctgggcatc
gccctgaccagcatggtctttgcccggttcggcgcgcgactggcccatcggctgtcgccg
cgcctgttgaagcgactgttcgccggcctgctgttcgtggtcggcctgacgttcctgctc
tga

DBGET integrated database retrieval system