KEGG   Pseudomonas cichorii: PCH70_12590Help
Entry
PCH70_12590       CDS       T03002                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pci  Pseudomonas cichorii
Pathway
pci00061  Fatty acid biosynthesis
pci00780  Biotin metabolism
pci01100  Metabolic pathways
pci01212  Fatty acid metabolism
Module
pci_M00083  Fatty acid biosynthesis, elongation
pci_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PCH70_12590
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PCH70_12590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pci01004]
    PCH70_12590
Enzymes [BR:pci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PCH70_12590
Lipid biosynthesis proteins [BR:pci01004]
 Fatty acid synthase
  Component type
   PCH70_12590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AHF66412
UniProt: W0H6E5
LinkDB All DBs
Position
1406922..1407362
Genome map
AA seq 146 aa AA seqDB search
MMDIKEIREYLPHRYPFLLVDRVTELDIENKSIRAYKNVSVNEPFFNGHFPDHPIMPGVL
IIEAMAQAAGILAFKLLDSKPADGTIYYFVGSDKLRFRQPVLPGDKLVLEAKFLSSKRQI
WKFECQATVDGKPVCSAEIICAERKL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggacattaaagaaattcgcgaatacctgcctcatcgttacccgtttctgttggta
gatcgcgtgacagagctggatatcgagaacaaaagcattcgcgcctacaagaatgtcagc
gtcaacgagccctttttcaacggccacttccctgatcatcccatcatgccaggggtcctg
atcattgaagcgatggctcaggctgccggtattcttgccttcaaactgctcgactccaaa
cctgccgacggcacgatttactatttcgtgggttcggacaagttgcgcttccgccagccg
gtgcttccgggcgacaagctggttctggaagcgaagtttctgagcagcaagcgccagatc
tggaagtttgaatgccaggccacggtcgacggtaagcctgtatgctccgcagaaatcatc
tgtgcggaacgcaagctatga

DBGET integrated database retrieval system