KEGG   Pseudomonas cichorii: PCH70_20040Help
Entry
PCH70_20040       CDS       T03002                                 

Definition
(GenBank) nitrate ABC transporter permease
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
pci  Pseudomonas cichorii
Pathway
pci00910  Nitrogen metabolism
pci02010  ABC transporters
Module
pci_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:pci00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PCH70_20040
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PCH70_20040
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pci02000]
    PCH70_20040
Transporters [BR:pci02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    PCH70_20040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AHF67157
UniProt: W0H8L1
LinkDB All DBs
Position
2243710..2244585
Genome map
AA seq 291 aa AA seqDB search
MNAESKSFKAAGTPVSVTGKPASRWPARIKNLRQFLVQGVLPPLVVGALFLLLWQMLCSG
KGAALPPPTQVIHETWELIIHPFYDNGGNDKGMAWQLLASLQRVAYGYTLAVVAGISLGV
LIGQSAWAMRALDPLFQILRTVPPLAWLPLSLAGFKDSHPSAIFVIFITAIWPIIINTSV
GVRNIPDDYRNVAKVLRLNGVEYFCKIMLPAAAPYIFSGLRIGVGLSWLAIIAAEMLIGG
VGIGFFIWDAWNASRISDIILALIYVGVVGFLLDRLVALIGHLVTRGTSAG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgaaagtaaaagcttcaaggccgcgggaacgcccgtgagcgttaccggcaag
cccgccagtcgctggcctgcacgaatcaagaacctgcgtcagttccttgtgcagggtgta
ttgccaccgctggtggtgggcgcgctgtttctattgctgtggcaaatgctctgcagcggc
aagggcgcggccttgccgccgccgacccaggtcattcatgaaacctgggaactgatcatc
catccgttctatgacaacggcggcaatgacaagggcatggcctggcaactgctcgccagc
ctgcaacgtgtcgcttacggctatacgctggcagtggtcgccgggatcagcctcggggtg
ctgatcggtcagtcggcctgggccatgcgtgcacttgacccgctgttccagatcctgcgc
accgtaccgccactggcctggttgccgctgtcgctggcaggcttcaaggacagtcaccct
tcggcgatcttcgtgattttcatcactgcgatctggccgatcatcatcaatacctcggtg
ggcgtgcgcaacattcccgatgactaccgcaacgtggccaaggtcctgcgtctcaatggc
gtggagtacttctgcaagatcatgttgcctgctgctgcgccgtacatcttctccggcctg
cgcataggtgtcggtctttcctggctggcgatcattgccgccgaaatgctgatcggtggc
gtgggtatcggtttctttatctgggatgcgtggaacgcctcgcgcatcagcgacatcatc
ctggcgctgatctacgtcggtgtcgtcgggtttctactcgaccggttggtggccctgatc
ggtcatctggtcactcgcggcacatcggccggttaa

DBGET integrated database retrieval system