KEGG   Pseudomonas cichorii: PCH70_23040Help
Entry
PCH70_23040       CDS       T03002                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pci  Pseudomonas cichorii
Brite
KEGG Orthology (KO) [BR:pci00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PCH70_23040
Enzymes [BR:pci01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PCH70_23040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored AlaDh_PNT_C Thi4 Glutaredoxin K_oxygenase FAD_binding_3 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AHF67457
LinkDB All DBs
Position
2599754..2601316
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTRPIEIVASLDDGAKSQEMLALLNDVLSVSKDITLQDNGTDAR
KPSFSLNSPGQNISLRFAGIPMGHEFTSLVLALLQTGGYPPKVSAETIEQVRALQGEFHF
ETYFSQSCQNCPDVVQALNLMAVLNPNIKHVAIDGALFQDEVTDRKIMSVPSIYLNGELF
GQGRMGLEEILAKIDTGASARQAEKLNAKDAFDVLVVGGGPAGSAAAVYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQHTEGPKLAVALEEHVKQYNVDIMNLQRADKLIPGKEGEL
HEVKFASGASLKAKTVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDVQLRADAVLQRKLHSLPNVTVITSAQTTEVTGDEQ
KVNGLRYKNRVNGEEVTVELEGIFVQIGLLPNSEWLKGAIELSPRGEIIVDARGETSVPG
IFGAGDVTIAPYKQIIIALGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaatcctacctggagcgggttactcgcccc
atcgagatcgttgcgtcccttgatgacggcgccaaatcccaggaaatgctggctctgctg
aacgatgtactcagtgtttccaaagacatcaccctgcaagacaacggcaccgatgcacgc
aagccatcgttctcgttgaacagccctggtcagaatatcagcctgcgtttcgccggtatt
cccatggggcacgaattcacctcgctggtcctggcgttgctgcaaacaggcggctaccca
cccaaggtcagtgcggaaaccatcgaacaggttcgcgccctgcaaggcgagttccatttc
gaaacctatttctcgcagtcttgccagaactgcccggacgtcgttcaggccctgaacctg
atggcggtcctcaatccgaacatcaagcacgtcgccatcgacggtgcgctgttccaggat
gaagtgactgaccgcaagatcatgtcggtaccgagcatctacctcaatggcgaactgttc
ggccagggccgcatgggcctggaagaaatcctcgccaagatcgacaccggcgccagcgct
cgtcaggctgaaaaactcaatgccaaggatgccttcgacgttctggtcgtcggcggtggt
ccagccggttcggccgcagcggtctacgcagcccgtaaaggcattcgtaccggtgttgcg
gcagagcgtttcggcggtcaggtgctggacaccatggcaatcgagaacttcatctcggta
caacacaccgaaggccctaaactggccgttgcgcttgaagagcacgtcaagcaatacaac
gtcgacatcatgaatctgcagcgcgccgacaagctgattcccggcaaagagggcgaactg
catgaagtgaagttcgccagcggtgcaagcctcaaggccaagaccgtgattctggctacc
ggtgcccgctggagggagatgaatgtccctggcgagcagcaataccgcaacaagggcgtt
gcctactgcccgcactgcgatggcccgctgttcaaaggcaagcgcgttgcagtgatcggc
ggtggtaactcgggcgttgaagcggccattgacctggcaggtatcgtctcccacgtgacc
ctgctggaattcgatgtgcaattgcgtgccgacgcagtcctgcagcgcaaactgcacagc
ctgccgaacgttaccgtgattaccagcgcccagaccactgaagtgactggcgacgagcag
aaggtcaacggcctgcgctacaagaaccgtgttaatggcgaagaagtgactgtcgagctg
gaaggtatcttcgtacagatcggcctgctgcctaacagcgaatggctcaagggtgccatc
gagttgtcgccacgtggcgagatcatcgtcgatgcacgcggcgagacttcggttccaggt
atcttcggtgccggtgacgtgacgattgctccttacaagcagatcatcatcgccctgggc
gaaggtgccaaggcttccctgagcgccttcgatcacctgatccgcacatctgctccggcc
tga

DBGET integrated database retrieval system