KEGG   Pseudomonas cichorii: PCH70_31430Help
Entry
PCH70_31430       CDS       T03002                                 

Definition
(GenBank) peptide synthase
Organism
pci  Pseudomonas cichorii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AHF68296
UniProt: W0H765
LinkDB All DBs
Position
complement(3758840..3771844)
Genome map
AA seq 4334 aa AA seqDB search
MDAFELPDTLAQALQRRAEQTPDHLALRFLTDEKDQGIVLTYRDLDRRARTIAAALKARA
EPGDRAILLFHSGPDYVAAFFGCLYAGVIAVPAYPPESNRRHHQERLLSIIADAEPRLLL
TGSDLRTALLQMDELADANAPQLLCVDTLDNAIAEGWQGPALNSDDIAFLQYTSGSTALP
KGVQVSHGNLVANERLIRHGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLM
APAYFLTRPLRWLEAISEYGGTISGGPDFAYQLCSSRVSDSALARLDLSRWRVAYSGSEP
IRQDSLDSFAEKFAVCGFTPDSFFASYGLAEATLFVAGGQRGKGIPSLRLDERALARNVA
EPGDGNPVMSCGTSQPEHGVLIADPQTLAVLGENSIGEIWACGPSIAHGYWRNPEATAKS
FVEHEGRTWLRTGDLGFLRHGELYITGRLKDMLIVRGHNLYPQDIEKAVERDVDVVRKGR
IAAFAVTQQGNEGIGIAAEVSRSVQKSLAPETLIKMIRQAVAEAFQEAPSVVVLLNPGAL
PKTSSGKLQRSACRTRLADGSLDSYAVFPESIVAAKEAASASSSNLQAQVAKIWCEHLQL
EEVAADDHFFLLGGNSIVATQVVASLREALGIELNLRLLFEAPTLAALVAQIEVLQRDGQ
TQDSIARLPGTDALPQSLAQNRLWFLWQMDPQGSAYNIPGGLHLRGELDITALRSSFQRL
IERHESLRTRFYEQDGVALQRIDPVSEFSLQVIDISDLSGEERQARAQAIREEQARLPFD
LQTGPLLRVTLVKLDDEEHQLLVTLHHIVADGWSLNVLIDEFSRLYAAAIQGQPLELAPL
SLRYADYGHWQREWLGRGEAQRQMDYWKAQLGDEQPALTLATDHPRSARKQHSASRYSLR
LSNELSAAVKQAAQAYQSTPFMLLLAGFQSLLHRYSGQNDIRIGVPGANRPRHETQGLIG
FFINTLVLRAQLDSRLPFSSLLAQTRQAALEAQANQDLPFDQLVEAFPQAREQGLFQVLF
NHQQRDLSALRRLPGLLAEELPWHSREAKFDLQLHSEEDRNGRLNLSFDYADELFERETI
VRMAAQFVRLLTQVCEQAEIVLGDVQLLCAEDLAEQVRWGAAPCAPAEQWLPELLNLQAR
QTPERIALMWDGGSLDFASLHAQANRLAHYLRDKGVGPDVKVAIAAERSPQLLIGLLAIL
KAGGAYVPLDPDYPTERLTYMLADSGVALLLTQSHLLGDLPSAEGVSTIVMDTLHLENWP
VSAPGLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYALDETDVLMQKAP
ISFDVSVWECFWPLITGCRLLLADPGEHRDPHRIAQRIKEYGVTTLHFVPPLLQLFIDEP
LAQQCSSLRRLFSGGEALPAELRNRVLEQLPNVQLHNRYGPTETAINVTHWHCQLADGER
SPIGRPLGNVLCRVLDSDLNPLPRGVAGELCIGGVGLARGYLGRPGLTAERFVVDPLGEE
GARLYRTGDLVRWAADGSLEYLGRLDQQVKLRGFRVEPQEIEARLLAQEGVGQAAVLVRE
TAAGPQLIGYYTAALEQDAEAGQIERIKSSLALELPEYMVPAQLVRLDSMPLSPSGKLDR
RALPEPVWQSREHVEPETELQKQVASIWREVLGVPRIGLRDDFFALGGHSLLATQIISRV
RQACDIELPLRALFEASELGAFVEQVQAIQASGARNSQQPIARIDRNQPVPLSYSQQRMW
FLWQMEPDSPAYNVGGMARLNGVLNIECFEAALQALILRHETLRTTFPSINGVACQKVSE
ETGLRMQWQDFSALQGDARQRRLQAFADSEAHTPFDLETGPLLRASMVRAGELEHYFVLT
LHHIVTEGWAMDIFARELGLLYEAFLEGRASPLEPLAVQYLDYSVWQRQWMEAGERQRQL
DYWTAQLGNEHPLLELPSDRPRPPVQSHKGELYRFDLSDELAARVRAFNASHGLTLFMTM
TATLAVLLYRYSGQNDLRIGAPVANRIRPESEGLIGAFLNTQVLRVQLDGQMCVEQLFEQ
VRHTVIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSRELAGMTVEYL
VNDARATKFDLNLEVTELDHRLGCCLTYSTDLFDEPRIAQMAGHLLNLLQALLADPAQRL
SELPLLQDAERQQLLDSLGVEAGEQRLDQCIHSLFAEQAKARPSAPALTFAGETLSYAEL
DGRANRLAWMLRERGVGPHVRVGLALERSLDMVVGLLAILKAGGAYVPLDPEYPLERLQY
MIEDSGVGLLLSHAALFEALGELPAGVGRWCLEDDLPALAAYPASELPFISLPQHQAYLI
YTSGSTGKPKGVVVSHGEIAMHCQAVIRRFEMRPDDCELHFYSINFDAATERLLVPLLSG
ARVVLRAQVQWDAEEICELIRSQHVNILGFTPSYGSQLAQWLSTQGQTLPVRMCITGGEA
LTGEHLQRIRAVFKPELFFNAYGPTETVVMPLASLAPAWLEEGEASVPIGSVVGARVAYI
LDADLALVPQGATGELYVGGAGLAQGYHERAAMTAERFVADPFSGNGGRLYRTGDLVRQR
ADGLVEYLGRIDHQVKIRGFRIELGEIETRLLEHEAIREAVVLALDTPAGKQLAGYLVTD
VVGQGEEQQAQLRESLKAHLKTQLPDYMVPAHLILLDSMPLTANGKLDRRALPAPDPELN
RQSYVAPTSELEQTLAGIWCAVLNVEKVGLNDNFFELGGDSILSIQVVSRARQAGIHFSP
RDLFQHQTVQTLAAVATTSKLVQAEQGLLTGESALTPIQHWFFETPIPERQHWNQALVLE
PTTALEPRYLEQALLAILEQHDALRLSFRDNAGKWKAEHRAVTGESLLLQARVSDMSECA
ALFADTQRSLDLQGGPLLRALLVDGPQGQQRLLMVIHHLVVDGVSWRVLLDDLQVAYRQL
VDAALVKLPAKTSAFRDWAGRLQAYAGSESLREELAWWQRQLSGPGAELPCDNPQGGQQN
IHAQTVSVRLDTQSTRQLLQQAPSAYRTQVNDLLLTALAQVVCRWSGQASALIQLEGHGR
ETLFDEIDLTRTVGWFTSAYPLRLTPGLADEDGPGASIKAIKEQLRQVPHKGLGYGVLRY
LADGNSRAAMQALPVAPITFNYLGQFDQSFGSDALFRPLDESAGAAHDAHAPLPNELSID
SQVYGGELVLRWTFSGERYQTQAITELAQAYLAQLQALIAHCLADGSGGLTPSDFPLAAL
DQAHLDALPVPAAHIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSELDPQRFAQ
AWQAVIARHEALRASFCWDIGETMLQVIHKPGNTPIDYLDWRDVAQSEQEPRLQALLKSE
REAGFDLLNQPPFHLRLIRVDEARYWFMMSNHHILIDAWCRSLLMNDFFDIYTALGEGRE
AHLAAPPRYRDYIGWLQRRGLVQARDWWRQNLKGFERPTPIPSDRPFLREHAGDSGGMVV
GDCYTRLDVADGVRLRELAQQHQLTINTFAQAAWALTLRRMSGDRDVVFGVTVAGRPVDM
PQMQRTVGLFINTIALRVGLPQDDQRCSVRQWLNRLLESNMELREYEYLPLVTIQENSEL
PKGQPLFDSLFVFENAPVEVSVLDRAQSLNATSDSGRTHTNYPLTAVCYPGDDLGLHLSY
DQRYFDETTVQGMLGEFKRLLLALIEGFHGDMSELALLSETEREFLLDGCNRSDHDYPLE
RSYAELFEAQVDAHPQRTVVSCLDRQYSYAELNALSNRLGHALIEAGAGFDQPIALLAER
GPELLGMIIGSFKAGAGYLPLDPALPNPRLSGIIQQSRTPVLVCSAECRDQAQALLADIA
EAGRPRLLVWEAVQQSELSQDNPGRYSAPDNLAYVIFTSGSTGLPKGVMVEQRGMLNNQL
SKVPYLNLSDADVIAQTASQSFDISVWQFLAAPLFGARVDIVPNDIARDPQALLSHVQAQ
RISVLESVPSLIQGLLAEERASLDGLRWMLPTGEAMPPELASQWLQRYPDIGLVNAYGPA
ECSDDVAFFRVDPESTRSTYLPIGTPTDNNRLYLLDEALELVPLGAVGELCVAGTGVGRG
YVSDPLRTVPVFVPNPFGATGERLYRTGDLARRRADGVLEYVGRVDHQVKIRGYRIELGE
IETRLQEHEAIRESVVLDIDGPLGKVLAAYLVPRGNAQDPDLLRDELKSHLKTSLPDYMV
PSHLVMLEAMPLTPNGKLDRKALPKPDVSQVQNDYVAPQSELEQQLATIWADVLKVERVG
ITDNFFELGGHSLLATQVVTRAQKLLQRNVPLRAMFEFNTIQGLAGHLEGLGGQKVDEQK
FDRLADLMAELEGL
NT seq 13005 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgtttgaactccccgataccctggcgcaagcccttcagcgtcgcgccgagcag
acgccggaccacctggccctgcgttttctcactgacgaaaaagatcagggcatcgtgctg
acctaccgtgatctggaccggcgtgcgcggaccatcgccgccgcgctgaaagcccgagcc
gagccgggtgatcgtgcgattctgttgttccacagcgggccggattacgtggcagcattc
tttggctgcctgtatgccggtgtgattgcggtgccggcctatccgccggaatccaatcgt
cgtcatcaccaggagcgtctgctgtcgatcatcgccgatgccgagccgcgcctgctgttg
accggctcggacctgcgcacggccttgctgcaaatggatgagctggcggatgccaatgcc
ccgcaactgttgtgcgtcgacaccctcgacaacgcaattgccgaaggctggcagggacct
gccctgaatagcgacgatatcgctttcctgcaatacacctcaggctcaactgctttgccc
aagggcgttcaggtgagccatggcaatctggtcgctaacgaacggttgatccgccacggc
ttcgggatcgatctcaaccccgatgacgtgattgtcagctggctgccgctataccacgac
atgggcttgatcggcggcttgctgcaaccgattttcagcggcgtgccttgtgtgctcatg
gcgccagcctatttcctgacccggccgctgcgctggctggaagcgatcagcgagtacggc
ggcaccatcagcggcggcccggatttcgcctatcagttgtgcagttcgcgggtcagcgat
tcggcgctggcgcgtctggacctcagccgctggcgcgtggcctattcaggctccgagccg
attcgtcaggacagcctggacagcttcgccgaaaagttcgctgtttgcggttttaccccg
gacagcttcttcgcttcctatggtctggccgaagcgacgctgttcgtggcgggtggtcag
cgtggcaagggcattccgtccttgcgtctggatgaacgcgccctggcgcgcaatgtggcc
gaaccgggcgatggcaatccggtcatgagttgcggcaccagccagcctgaacacggcgtg
ctgattgccgatccccagacccttgccgtactgggtgaaaacagcatcggtgaaatctgg
gcctgtggcccgagcatcgcccacggttactggcgtaaccccgaagccacggccaagtct
ttcgtcgagcatgaaggccgtacctggctgcgcaccggcgacctgggtttcctgcgccat
ggcgagctgtatatcaccggtcgcttgaaagacatgctgatcgtgcgtggccataacctg
tacccgcaggacatcgaaaaggctgtcgagcgtgacgtcgatgtggtgcgtaaaggccgg
attgccgcgttcgccgtgacccagcagggcaacgaaggcattggcatcgcggcagaagtc
agccgcagcgtgcagaaaagcctggctcccgagacgctgatcaagatgattcgtcaggct
gttgccgaggccttccaggaagcaccgagcgtggtggtgctgctcaatccgggtgccttg
cccaagacctccagcggcaaactgcaacgttccgcctgccgcacccgactggccgacggc
agcctggacagttatgcggtcttcccggaaagcatcgtggctgccaaggaagcggcttcg
gcttccagctccaatctacaggcgcaggtggcgaaaatctggtgtgaacacctgcaactg
gaagaggtggccgccgatgatcacttcttcctgctgggcggtaactcgattgtcgcgact
caggtggtcgccagtttgcgtgaagcgctgggtatcgaactgaacctgcgcctgttgttt
gaagctccgaccctggcggcgctggttgcacagatcgaagtgctgcaacgcgatggccag
acacaagacagcattgcccgcttgccgggcaccgatgcgctgccgcaatccctggcccag
aaccgcttgtggttcctctggcaaatggacccgcaaggcagcgcctacaacattcccggt
ggcctgcacctgcggggcgaacttgatatcacggcgctgcgcagcagcttccagcgcctg
atcgaacgccatgagtccctgcgcacccgtttttacgagcaggacggcgtggccttgcag
cgtatcgatccggtcagcgagttttcgttgcaggtgatcgatatcagcgacctgtccggc
gaagagcgtcaggcccgtgcccaggctatccgcgaagaacaggcacgcctgcctttcgat
ctgcaaactggcccgttgctgcgcgtcacgctggtgaagctggacgatgaagagcatcaa
ttgctggtcacgctgcatcacatcgtggccgatggatggtcgctgaatgtgctgatcgac
gagttctcgcgcctctacgccgctgccattcaggggcagccactggagttggcgccgctg
tcgttgcgttatgccgattacggccactggcagcgtgaatggctgggccggggcgaggct
cagcgtcaaatggattactggaaggcgcaactgggtgacgagcagccagccctgactctg
gccaccgatcatccgcgttcggcccgcaagcaacacagcgcttcgcgttacagcctgcgc
ctgagcaacgagttgagcgccgcagtaaaacaggccgcccaggcttatcagtcgaccccg
ttcatgctgctgctcgccggtttccagagcctgctgcatcgctacagcgggcagaacgat
attcgtatcggcgtgcctggcgccaaccggccgcgccatgaaacccagggcctgatcggt
ttcttcatcaacaccctggtgctgcgggcgcaactggattcgcgcctgccattttcctcg
ctgctggcacaaacccgtcaggcggcgctggaagcccaggccaatcaggacctgccgttc
gatcaactggtcgaggcgttcccgcaggcccgtgagcagggtctgtttcaggttctgttc
aaccatcagcagcgggatctgagcgccttgcggcgtctgccgggtttgctggccgaagaa
ctgccgtggcacagccgtgaagccaagttcgacctgcaattgcacagtgaagaggaccgc
aacggtcggctgaacctgtccttcgactatgctgacgagctgttcgagcgcgaaaccatc
gtgcgcatggccgcacagttcgtgcgtctgttgactcaagtctgcgagcaggccgagatc
gttctgggcgatgtgcagttgctctgcgccgaggatctggccgagcaggtccgttggggc
gctgcgccttgcgcacctgccgaacaatggttgccggagcttctgaaccttcaggcccgc
cagaccccggaacgtattgccctgatgtgggacggcggcagcctcgactttgccagcctg
catgcccaggccaaccgtctggcccactacctgcgcgacaagggcgtcggcccggacgtc
aaggtggcgattgccgccgagcgctcgccgcaactgctgatcggcctgctggcgatcctc
aaggctggcggcgcctatgtaccgctggacccggattacccgaccgagcgactgacctac
atgctcgccgacagcggcgttgcgttgctgctgacccaaagccatttgctgggcgatctg
ccgagcgccgaaggcgtcagcaccatcgtcatggacaccttgcacctggaaaactggccc
gtcagcgcgccgggcctgcacctgcatggcgataacctggcgtacgtgatctacacctcc
ggctctaccggccaacccaagggagtgggcaacacccatgccgcactggccgagcgtctg
caatggatgcaggccacttacgcactggacgaaaccgatgtgctgatgcagaaggcaccg
atcagtttcgacgtttcggtgtgggagtgcttctggccgctgattacgggctgtcgtctg
ttgctggccgatcccggcgagcatcgcgatccgcatcgcattgcccaacgcatcaaggaa
tacggcgtcaccacgctgcatttcgtgccgccgctgctgcaactgttcatcgatgagccg
ctggcgcaacagtgcagcagcctgcgtcgtctgttttccggcggtgaagccttgcctgcc
gaactgcgcaaccgggtgctggagcaactgccgaatgtgcaactgcacaaccgttatggc
ccgactgaaaccgcgatcaacgtcactcactggcactgtcagttggcggatggcgagcgc
tcgccgattggccgtccgctgggcaacgtgctgtgccgggttctggacagcgacctgaac
ccgctgccccgtggcgtggccggtgagttgtgcatcggcggtgtcggtctggctcgcggc
tatctcgggcgtccggggctgacggccgagcgttttgtcgtcgatccgctgggcgaagag
ggcgcacgtctgtaccgcaccggcgacctggtgcgctgggcggcggacggttcgctggag
tatctggggcgtctggaccagcaggtcaaactgcgtggctttcgggtcgagcctcaggaa
atcgaagcccgtctgctggctcaagaaggcgttgggcaggctgcggtgctggtgcgggaa
accgccgctggcccgcaactgatcggttactacacggcagcgctggaacaggacgccgag
gccgggcagatcgagcgcatcaagtcttccctggcccttgaactgcctgagtacatggtc
cctgcgcaactggtgcgtctggacagcatgccgttgagccccagcggcaaactggatcgc
cgcgccttgcccgagccggtctggcagagccgtgaacacgtcgagcccgaaacggagctg
caaaaacaggtcgctagtatctggcgcgaagtcctgggcgtgccgcgcattggtttgcgc
gatgacttctttgccttgggcggacactcgttgctggccacccagatcatctccagggtg
cgtcaggcctgcgatatcgagctgccgttgcgggcgctgttcgaggccagtgagctggga
gcgtttgtcgagcaggtccaggccattcaggcgtccggtgcccgcaacagccagcagccg
attgcccggatcgaccgcaaccagccagtgccgctgtcctattcccagcagcgcatgtgg
ttcctgtggcagatggaaccggacagcccggcctataacgtaggcggtatggcgcgcctg
aatggcgtgctgaatatcgagtgcttcgaggccgcactgcaagccttgatcctgcgccac
gaaaccctgcgcaccaccttcccgagcatcaacggcgtggcttgccagaaagtctccgag
gaaaccggcctgcgcatgcagtggcaggatttctcggcgctgcaaggtgacgctcgtcag
cgtcgcttgcaagcattcgctgacagcgaggcgcacacgcctttcgatctggaaaccggc
ccgctgctgcgtgccagcatggtccgtgctggcgagctggaacactacttcgtgctgacc
ttgcaccacatcgtcaccgaaggctgggcgatggatatctttgcccgtgaactgggcctg
ctgtacgaagcctttcttgaaggccgtgcttcgccgctggaacccctggcggtgcaatac
ctggattacagcgtctggcagcgtcagtggatggaagcgggtgagcgtcagcgccaactg
gattactggacggcgcaactgggcaacgagcatccgctgctggaattgccgagcgaccgt
ccgcgtccgccggtgcagagccacaagggcgagctgtatcgtttcgacctgagcgatgaa
ctggccgcccgcgtgcgggctttcaacgccagccatggcttgaccctgttcatgaccatg
accgccaccctggcggtgctgctctaccgttacagcggccagaacgatctgcgcatcggc
gctccggtggccaaccggattcgtccggaaagcgaagggttgattggtgcattcctcaat
acccaggtgctgcgcgtccagctcgacgggcaaatgtgcgtcgagcaactgttcgagcag
gttcgtcacacggtcatcgaaggtcagtcccatcaggacttgccgttcgatcatctggta
gaagccctgcaacctccacgcagcgcggcttataacccgctgttccaggtgatgtgcaac
gtgcagcgctgggagttccagcagagccgcgaactggccggcatgactgtcgaatacctg
gtcaacgatgcccgggccaccaagttcgacttgaacctggaagtcaccgaactggatcat
cgcctgggttgctgcctgacctacagcaccgatctgttcgacgagccgcgcatcgcgcaa
atggccgggcacttgctcaacctgctgcaagccttgctggccgatccggcgcagcgcttg
agcgaactgccgctgttgcaggacgccgagcgtcagcagttgctcgacagcttgggtgtc
gaggcgggtgagcagcgtctggatcagtgcatccacagcctgtttgccgaacaggccaaa
gcacgcccgagcgcaccggctttgaccttcgccggtgaaaccctgagctatgccgaactg
gatggccgcgccaatcgtctggcctggatgctgcgcgagcgtggtgttggcccgcacgtg
cgtgtcggcctggcgctggagcgctcgctggacatggtggtcggcctgctggcgatcctc
aaggccggtggcgcctatgtgccgctggacccggagtacccgctggagcgcctgcaatac
atgatcgaagacagcggcgtcggtctgctgttgagccatgctgccttgtttgaggccttg
ggcgaactgcctgcaggcgtcggtcgctggtgcctggaagatgacttgcccgcgctggct
gcttacccggcgagcgagttgccgttcatcagcctgccgcagcatcaggcgtacttgatt
tacacctccggctccaccggcaagccaaagggcgtggtggtgtcccacggtgaaatcgcg
atgcattgtcaggcggtgattcgccgcttcgagatgcgtcccgatgactgtgagttgcac
ttctattccatcaacttcgacgcggccaccgagcgtctgctggtgccactgctcagcggg
gcgcgggtggtcttgcgtgcccaggtgcagtgggacgccgaagaaatctgcgaactgatc
cgcagccagcacgtgaacattctcggtttcaccccaagctatggcagccagttggcgcaa
tggctttcgactcagggccagacgttgccggtgcgcatgtgtattaccggtggcgaggcg
ctgaccggtgagcatttgcagcgtattcgggcggtgttcaagcctgagctgttcttcaac
gcctatggtccgactgaaaccgtggtcatgccgctggccagtctggcaccggcctggctg
gaagagggcgaagccagcgtgccgatcggcagcgtggtgggcgctcgggtggcgtatatc
ctcgatgccgatctggcgttggtgccccaaggggcgaccggtgaactgtatgtcggcggc
gccggccttgctcagggttaccacgagcgggcggcgatgaccgccgagcgttttgtcgcc
gatccgttcagtggcaatggcgggcgtctgtatcgcaccggcgatctggtgcgccagcgt
gccgatggcctggtggagtacctgggccggatcgaccatcaggtgaagattcgcggtttc
cgtatcgaactgggcgaaatcgaaacccgcctgctggaacacgaagccatccgcgaagcc
gtggtgctggcgctggatacgccagcgggcaagcaactggccggttatctggtcactgat
gtggttgggcagggcgaggagcaacaggcacaactgcgcgagtcgctcaaggcgcatctg
aagacgcaactgccggattacatggtgcctgcgcatctgatcctgctggacagcatgccg
ctgaccgccaacggcaagctcgaccgccgcgccttgccagcgccggacccggaactcaat
cgtcagagttatgtggcaccgaccagcgaactggagcagaccctggcgggtatctggtgc
gcggtgttgaacgtggaaaaagtcggcctcaacgacaacttcttcgagttgggcggcgat
tcgatcctgtcgatccaggtggtcagccgtgcgcgtcaggccgggattcatttcagtcct
cgcgacctgttccagcaccagaccgttcagaccctggccgccgtggccaccaccagtaag
ctggttcaggccgagcaaggtctgctgaccggcgaatcggccctgacgccgattcagcac
tggttcttcgagacgccgatccctgagcgccagcactggaatcaggcgctggtgctggag
ccgaccacggccctggagcctcgttatcttgagcaggcgctgctggcgattcttgaacag
cacgatgccttgcgcctgagcttccgggacaacgccggaaaatggaaggccgagcaccgt
gctgtcaccggtgaaagcctgctgctgcaagcgcgtgtttcggacatgagcgagtgcgcc
gcactgtttgcggacacccagcgcagcctggatctgcaaggcggcccgctgttgcgtgcc
ttgctggtggatgggccgcagggccagcagcgcctgttgatggtcattcaccacttggtt
gtcgatggtgtttcatggcgcgtgctgctggacgatctgcaagtcgcctatcgccagctt
gtcgatgccgcactcgtcaaactgccagccaagaccagtgccttccgtgactgggccggg
cgtctacaggcttacgccggtagcgaatccttgcgcgaagaacttgcctggtggcagcgt
cagctcagcgggccgggggctgaattgccttgcgataatccgcagggcgggcagcagaat
attcatgcacagaccgtcagtgtgcgtctggatacgcaaagcacccgacagttgctgcaa
caggcgccgagcgcttatcggactcaggtcaacgatttgctgctgaccgcgctggcacag
gtggtctgccgctggagcgggcaggcgtcggcgttgattcagctcgaaggccatggccgc
gaaaccctgttcgacgaaatcgacctgacccgcaccgtgggctggttcaccagcgcctat
ccgctgcgcctgacgcccggattggccgacgaggatgggccgggcgcatcgatcaaggcg
atcaaggagcagttgcgtcaggtccctcacaagggcctgggttatggcgtgctgcgttat
ctggccgatggcaacagccgcgctgcaatgcaagccttgccggtcgcgccgatcactttc
aactacttggggcagttcgaccagagctttggcagcgatgccttgttccgtccgctggat
gagtcggcgggtgcggcccatgacgcccatgcaccgttgccaaacgaactgagcatcgac
agtcaggtgtacggcggcgaactggtgctgcgctggacgttcagtggagagcgttaccag
acccaggccatcaccgaactggcgcaggcttatctggcgcagttgcaggcgctgattgcc
cattgtctggcagacggcagcggcggcctgacaccttcggatttcccgctggccgctctg
gatcaggcgcatctggatgcgctgccggtaccggcagcgcatatcgaagatgtctacccg
ctgactccgatgcaggagggcatgttgctgcacaccctgctggaaccgggcaccggcctg
tattacatgcaggatcgctatcgcatcaacagcgagctggacccgcaacgtttcgcccag
gcctggcaggcggtcattgcccgtcacgaagccctgcgtgcctcgttctgctgggatatc
ggcgaaaccatgctgcaagtcattcacaaacccggcaacacgccgatcgattatctggac
tggcgcgatgtggcgcagagcgagcaggagccgcgtctgcaagccttgctcaagtccgaa
cgcgaggccggtttcgacttgctcaatcagccgccgttccacctgcgcctgattcgtgtc
gacgaggcccgctactggttcatgatgagcaaccaccacatcctgatcgatgcctggtgc
cgctcgttgctgatgaatgacttcttcgacatctacaccgcgctgggcgaaggccgcgag
gcacacctggccgcgccgccgcgctatcgtgattacatcggctggttgcagcgtcgcggt
ctggtacaggcccgtgactggtggcggcagaacctcaagggtttcgagcgtccgacgccg
atcccgagcgaccgtccgttcctgcgcgagcatgccggtgacagtggcggcatggtggtg
ggggattgctacacccgtctggatgtggccgatggtgtacgactgcgcgaactggcacag
cagcatcaactgaccatcaacacctttgcccaggcagcctgggccttgaccttgcggcgc
atgagcggtgaccgggacgtggtgttcggtgtgaccgtggccggccgtccggtcgacatg
ccacagatgcagcgcacggtgggcctgttcatcaacaccatcgccctgcgcgtgggcttg
ccgcaggatgaccagcgttgcagtgttcgccagtggctgaaccgtttgctggaaagcaac
atggagctgcgcgagtacgagtacctgccgctggtgaccatccaggaaaacagcgagctg
cccaagggccagccgttgttcgacagtctgttcgtgttcgagaacgcgccggttgaagtc
tcggtgctggaccgtgcgcaaagcctcaatgccacttcggattcaggccgtacccacacc
aactatccgctcacggcagtgtgctaccccggcgatgacctggggctgcatctgtcctat
gaccagcgctacttcgacgaaaccacggtgcaaggcatgctgggcgagttcaagcgcctg
ctgctggccttgatcgaaggtttccatggcgatatgtccgagctggcgctgctgagtgaa
acggagcgcgagttcctgctcgatggctgcaacaggagcgatcacgactacccgctggag
cgcagctatgccgagttattcgaggcgcaggtcgatgctcatccgcaacgtacggtcgtc
agttgcctggatcgccagtacagctatgccgagttgaatgcactcagcaaccgccttggc
catgccttgatcgaggccggagccggtttcgatcagccgatagccttgctggccgagcgt
ggtcccgaactgctgggcatgatcatcggcagcttcaaggccggtgccggttacctgccg
ctggacccggcgctgccgaacccgcgtctgagcggcatcattcagcaaagccgcacgccg
gtgctggtgtgcagtgccgaatgccgtgaccaggctcaggccttgctggccgatatcgct
gaagcgggtcgtccacgtttgctggtctgggaagcggtgcagcagagtgagctgtcgcag
gacaatcccggtcgatacagcgcgccggacaatctggcctacgtgatcttcacctcgggc
tccaccggattgcccaaaggggtcatggtcgagcaacgcggcatgctcaataaccagttg
agcaaggtgccttatctgaacctgagcgatgcagacgtgattgcccagaccgcttcgcaa
agcttcgatatctcggtctggcagttcctggcagcgccattgttcggtgcgagggtggac
atcgtgccaaacgatatcgcccgtgatccacaggccttgctgagtcacgttcaggctcag
cgcatcagcgtgctggaaagcgtgccgtccctgattcaagggttgctggccgaggagcgc
gcaagcctcgatggcctgcgctggatgctgcccactggtgaagccatgccgccggagctt
gccagccaatggttgcaacgctacccggatatcgggctggtcaacgcttatggtcctgcc
gaatgttcagacgacgtggcgttcttccgcgtcgatccggagtcgactcgcagcacctac
ctgccgatcggcacgccaacggacaacaaccgtttgtacctgctcgacgaggcgctggag
ctggtgccgctgggcgccgtcggcgagctgtgcgtggccgggaccggtgtcggtcgtggt
tatgtcagcgacccgttgcgcaccgtgccggtgtttgtgcccaacccgttcggtgcaacc
ggcgagcgtctgtatcgcaccggcgaccttgcgcgaagaagggctgacggcgtgctcgaa
tacgtgggccgggtcgaccatcaggtgaagattcgcggctaccgcatcgaactgggcgag
atcgaaacccgcctgcaggagcacgaagcgatccgtgaatctgtggtgctggatatcgac
ggaccgttgggtaaggtgctggcggcgtatctggtgccgcgtggcaatgcacaggacccg
gacttgctgcgcgatgaactgaaaagccacctcaagaccagcctgccggactacatggtg
ccaagccatctggtgatgctggaggccatgccgttgaccccgaatggcaagctggaccgc
aaggccctgcccaagccggatgtcagccaggtgcagaacgattatgtggcaccgcagagc
gagcttgagcagcaactggcgacgatctgggctgatgtgctgaaggtcgagcgtgtcggc
atcaccgacaacttcttcgagttgggcgggcattcgctgctggcgactcaggtggtgacc
cgggcgcagaagctgctgcaacgcaatgtaccgctgcgcgcgatgttcgagttcaacacc
attcaagggttggcggggcatctggaaggccttggcgggcagaaggtcgatgaacagaaa
ttcgaccggctggcggacctgatggctgaactggaggggctgtaa

DBGET integrated database retrieval system