KEGG   Pseudomonas cichorii: PCH70_38270
Entry
PCH70_38270       CDS       T03002                                 

Definition
(GenBank) sensor histidine kinase
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
pci  Pseudomonas cichorii
Pathway
pci01503  Cationic antimicrobial peptide (CAMP) resistance
pci02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pci00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PCH70_38270
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    PCH70_38270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pci01001]
    PCH70_38270
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pci02022]
    PCH70_38270
   01504 Antimicrobial resistance genes [BR:pci01504]
    PCH70_38270
Enzymes [BR:pci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     PCH70_38270
Protein kinases [BR:pci01001]
 Histidine kinases
  OmpR family
   PCH70_38270
Two-component system [BR:pci02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   PCH70_38270
Antimicrobial resistance genes [BR:pci01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    PCH70_38270
SSDB
Motif
Pfam: HATPase_c HisKA HATPase_c_2 HATPase_c_5 ArlS_N HATPase_c_3 CorA
Other DBs
NCBI-ProteinID: AHF68980
LinkDB
Position
complement(4491091..4492434)
AA seq 447 aa
MIRSLRLRLMLAAATLAVIFMLLMLPALQGAFSLALRGAIEQRLAADVTTMISAARVEDG
RLLMPSLLPSEQFNLPGSRLLGYIYNLQGQLVWRSLGTEGENIKYRPHYDGQGSLFSKIK
EANGDEYFVYDAEIRLLGGRNAAFSIVAVQPLRDYQETIADLRKKLYLGFGGALLVLLGL
LWLGLTWGLRALKGLSQELDQVEAGARDSLSEEHPSELLRLTDSLNRLLRSEREQRTRYR
DSLDDLAHSLKTPLAVLQGVSENIAKRPEDVEQARVLQSQIERMSQQIGYQLQRASLRKS
GLVRHHVKLRPVVESLCNTLEKVYRDKQVKVTLDLPEDCQVPMEEGALLEMLGNLLENAY
RLCLGEVRVSFQSSATGDELCVEDDGPGIPLRQRARILERGERLDRQNPGQGIGLAVVKD
IIESYSARLTLGDSPLGGAVFRIHFLA
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgattcgttcgctgcgcctgcgtttgatgctggccgccgcaaccctggcggtgattttc
atgctgctgatgctgcctgccttgcagggcgcattcagcctggcattgcgtggcgcaatc
gagcagcgtctggcggcggacgtaacgaccatgatttctgcggcgcgtgtcgaagatggt
cgcctgctgatgccatcgctcctgcccagcgagcagttcaatctgccgggcagtcgcttg
ctgggctacatctataaccttcaggggcaactggtctggcgttcgctgggcactgaaggc
gaaaacatcaaataccgcccgcactatgacgggcagggcagtctgttttccaagatcaag
gaagccaatggcgatgagtatttcgtctacgacgccgagatccgtctgctgggcggccgc
aatgcggcgttcagtatcgtggccgtgcaacccttgcgcgactatcaggaaaccattgcc
gatttacggaaaaaactttatctgggcttcggcggcgccttgctggtgttgctggggctg
ttgtggcttgggctgacctgggggctgcgcgcgctcaagggcttgagccaggaactggat
caggtggaagccggtgcgcgggacagcctgagtgaagaacatcccagcgaactgctgcgc
ctcaccgactccctgaaccgtctgctgcgcagtgagcgcgagcaacgcactcgttatcgc
gattctctggatgatctggcccatagtctgaaaacaccgctggcggtgttgcagggtgtc
agcgagaacatcgccaagcgccctgaagatgtggagcaggcgcgggtcctgcaatcgcag
atcgagcgcatgagccagcagatcggttaccagttgcagcgcgccagcctgcgcaagagc
ggtctggtccggcatcacgtgaagctgcgcccggtggtcgaaagcctgtgcaacaccctg
gaaaaggtttaccgcgacaagcaggtcaaggtcacgctggacctgcccgaggactgccag
gtgccgatggaagagggcgcgttgctggaaatgctcggcaatttgctggaaaacgcttac
cggctttgtctgggggaagtcagagtcagttttcagtcatctgcaacgggtgacgaattg
tgcgtcgaagacgatggccccggcatcccgctgcgccagcgagcgcgcattctggagcgc
ggtgagcgactggaccgccagaacccggggcagggcatcgggctggcggtggtcaaggac
atcatcgaaagctacagcgcccgcctgactctgggcgactcgccgctgggtggggcagtg
ttcaggattcattttctggcgtga

DBGET integrated database retrieval system