KEGG   Proteus cibarius: F9282_09755Help
Entry
F9282_09755       CDS       T06330                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pcib  Proteus cibarius
Brite
KEGG Orthology (KO) [BR:pcib00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    F9282_09755 (ahpF)
Enzymes [BR:pcib01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     F9282_09755 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored Thi4 FAD_binding_3 NAD_binding_8 AlaDh_PNT_C K_oxygenase DAO Lycopene_cycl NAD_binding_7 FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: QGW03251
LinkDB All DBs
Position
complement(2024839..2026404)
Genome map
AA seq 521 aa AA seqDB search
MLDNNLKAQLKAYLERLTQPVELVATLDDSKHSADIQALLKEIEPLSDKVTYREDNNANV
RKPSFLITNPGKETGVRFAGSPLGHEFTSLVLALLQTGGHPSKEAQELLEQIRQLDGEFH
FETYYSLSCHNCPDVVQALNLMAILNPKITHTAIDGGMFQNEIQERNIMGVPAVFLNGNE
FGQGRMTLAEIVNKVDSNAEKRTAELLNQKDAFDVLIVGSGPAGASAAVYSARKGLNTGL
IGERFGGQVLDTVDIENYISVPKTEGAKLAGALKAHVDDYQVDVIDSQTVSRLIPGASEG
ELHQIETASGAILKTRSLIIATGARWRNMNVPGENEYRTRGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGLVEHVTVLEFAPEMRADAVLQKKLRSLGNVEVILNAQTTEVYGD
GTKLTGLKYKDRTNDSMHDIALAGIFVQIGLLPNTQWLEGTVERNKMGEIVVDARGETNI
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTSAK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagataataatttaaaagctcaattgaaagcttatttagaacgattaacccagcca
gttgagttagtagcaacattagacgacagcaaacattctgctgatatccaagcgctatta
aaagaaatcgaaccattatccgataaagtcacttatcgtgaagataataacgctaatgta
cgtaaaccatcttttcttattaccaacccagggaaagaaacgggtgttcgctttgcgggc
tcgccattaggtcatgaatttacttcattggttttagcattattgcaaaccggtggccat
ccatcaaaagaagcacaagaattacttgaacaaattcgtcagttagacggtgagtttcat
ttcgaaacctattattcgctctcttgtcataactgcccagatgttgttcaggcattaaac
ttaatggcgattttaaatccgaagatcacacatactgcgattgacggaggcatgttccaa
aatgaaattcaggaacgtaatatcatgggcgttcctgctgtattcttaaatggtaacgag
tttggtcaaggtcgcatgaccttagctgaaatcgttaacaaagtagacagcaatgcagaa
aaacgtactgcagaattgttaaatcaaaaagatgcatttgatgtattgattgtgggtagt
ggccctgctggtgcatcagctgctgtttattctgctcgtaaaggtttaaatacaggtctt
attggtgaacgttttggtggccaagttcttgatactgttgatattgaaaactatatttca
gtaccgaaaaccgaaggtgcaaaacttgctggtgcattaaaagcccatgttgatgattac
caagtggatgtgattgatagccaaactgttagtcgtttaattccaggggcgtcagaaggg
gaattacaccaaattgaaacggcatcaggtgcaattttaaaaactcgtagcttaattatt
gcgacaggtgcccgctggagaaatatgaatgttcccggtgaaaatgagtaccgtactcgt
ggtgtaacttattgcccacactgtgacggcccactgtttaaaggaaaaagagttgctgtt
attggtggtggtaactcaggtgttgaagctgcaattgacttagctggcttagttgaacac
gtaacagtattagaatttgctccagaaatgagagcagatgcggtattacagaaaaaatta
cgtagcttaggcaatgtagaagttatcttaaatgcgcaaaccacagaagtgtatggcgat
ggcactaagttaactggcctaaaatacaaagatcgtactaatgattctatgcacgatatt
gcattagcaggtattttcgttcaaatcggtttattacctaatacacagtggttagaaggt
actgttgagcgtaataagatgggtgaaattgttgttgatgcccgtggcgaaactaatatc
aaaggtgtatttgctgccggtgactgtacaacagttccttataagcaaatcattatcgcc
gcaggtgaaggtgctaaagcctcattaagcgcatttgattacttaattcgcacgagtgca
aaataa

DBGET integrated database retrieval system