KEGG   Proteus cibarius: F9282_19375
Entry
F9282_19375       CDS       T06330                                 

Gene name
mnmG
Definition
(GenBank) tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
pcib  Proteus cibarius
Brite
KEGG Orthology (KO) [BR:pcib00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pcib03016]
    F9282_19375 (mnmG)
   03036 Chromosome and associated proteins [BR:pcib03036]
    F9282_19375 (mnmG)
Transfer RNA biogenesis [BR:pcib03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    F9282_19375 (mnmG)
 Prokaryotic type
    F9282_19375 (mnmG)
Chromosome and associated proteins [BR:pcib03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    F9282_19375 (mnmG)
SSDB
Motif
Pfam: GIDA GIDA_assoc FAD_oxidored FAD_binding_2 Pyr_redox_2 HI0933_like AlaDh_PNT_C DAO MarR_2 Pyr_redox Thi4 Pyr_redox_3 NAD_binding_8 NAD_binding_9
Other DBs
NCBI-ProteinID: QGW05014
LinkDB
Position
4134057..4135955
AA seq 632 aa
MFYPEHFDVIVIGGGHAGTEAAMAAARMGRQTLLLTHNIDTLGQMSCNPAIGGIGKGHLV
KEIDAMGGLMATAIDHAGIQFRTLNASKGPAVRATRAQADRVLYRQAVRTTLENQPNLMI
FQQPVEDLIVENDQVTGAVTRMGLKFRAKSVVLTVGTFLDGKIHIGLENYSGGRAGDPPS
VSLSHRLRELPLRVGRLKTGTPPRIDARTIDFSQLAVQLGDTPMPVFSFLGNVDQHPEQM
PCHITYTNEKTHDIIRNNLDRSPMYAGVIEGIGPRYCPSIEDKVMRFADRNSHQIFLEPE
GLTSNEIYPNGISTSLPFDVQMQIVNSMKGMENAKIIRPGYAIEYDFFDPRDLKQTLESK
FINGLFFAGQINGTTGYEEAAAQGMLAGLNAARYAFDQEGWFPRRDQAYIGVLVDDLCTL
GTKEPYRMFTSRAEYRLMLREDNADLRLTEIGRELGMVDDNRWAQFSEKVELVEKERQRL
RNIWVHPQADNLSEINGLLNTPLSKEANGEDLLRRPEMTYDILKNITRFAPGIDDSKPQA
AEQVEIQVKYEGYISRQKEEIEKQLRNENAALPIDLDYKQVSGLSNEVIAKLNDHKPTSI
GQASRISGVTPAAISILLVWLKKQGLLRRSAS
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgttttatccagaacactttgacgtcattgtcatcggtggtggtcacgccggtacagaa
gccgctatggctgctgctcgtatggggcgtcaaaccctattactgacccacaatattgat
actttgggccaaatgtcttgtaacccagctattggtgggattggtaaagggcatctggta
aaagagatcgatgccatgggtggattaatggcaaccgctattgaccatgcagggatccaa
ttcagaacccttaacgcaagtaagggcccagctgtaagagcaacaagagcacaagctgac
cgtgttctttatcgccaagctgttcgtactactcttgaaaatcaacctaatttaatgatc
ttccaacaacctgttgaagatctcattgttgaaaacgaccaagtgacaggtgctgtcact
cgcatgggcttaaaattccgtgctaaatctgttgttctaaccgttggtactttcctagat
ggtaaaatccatattggtttagaaaattacagtggtggtcgtgctggtgatccaccttca
gtttcattatcacacagactacgcgaattacctctacgtgtaggtcgtttaaaaacaggt
acaccaccccgtattgatgctagaactatcgattttagccaactagctgttcagttgggt
gatactccaatgcctgttttctcgtttttaggaaatgtggatcagcatcctgaacaaatg
ccttgccatatcacatacacaaacgaaaaaacgcacgatattattcgtaataaccttgat
cgtagcccaatgtacgccggtgtcatcgaaggaatagggcctcgttattgcccatctatt
gaagataaagtgatgagatttgctgatcgtaattcacatcagatctttttagagcctgaa
ggtttaacgagtaacgagatttacccaaatggaatttcaacgagcttaccttttgatgtt
caaatgcagatcgtaaattccatgaaaggtatggaaaatgcgaagatcattagacctggt
tatgctattgaatatgacttcttcgatcctagagatctaaaacaaaccctagaaagcaaa
tttatcaacgggttattctttgctggccaaattaacggtacaaccggttatgaagaagca
gctgctcaaggcatgcttgcaggacttaacgcggcacgttatgccttcgatcaagaaggt
tggttcccacgtcgtgatcaagcatacattggtgtattagttgacgatctttgtactctt
ggtacaaaagagccataccgcatgtttacttctcgtgctgaatatcgcttgatgttacgt
gaagataatgctgatttacgtctaactgaaattggtcgtgaattaggtatggttgatgac
aaccgttgggcacaatttagtgaaaaagttgagcttgttgaaaaagaacgtcaacgttta
agaaatatttgggttcatccacaagctgataatctttctgaaatcaatggattactaaat
acaccattatctaaagaagctaatggcgaagatttattacgtcgccctgaaatgacttac
gacatactgaagaatattactcgttttgcaccgggtattgatgattcaaaaccgcaagca
gctgaacaagttgagatccaagttaaatacgaaggctacattagtcgccagaaagaagag
atcgaaaaacaactgcgcaacgaaaatgctgcgttaccgattgatctggactataaacaa
gttagcggattatctaacgaagttattgcaaaacttaacgatcacaaaccaacatcgatt
ggacaagcatcgcggatctcaggagtcacacctgctgctatttccattttattagtttgg
ttgaaaaagcagggcctattacgtaggagtgcatcatga

DBGET integrated database retrieval system