KEGG   Paraburkholderia caledonica: CUJ87_00430Help
Entry
CUJ87_00430       CDS       T05740                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pcj  Paraburkholderia caledonica
Pathway
pcj00970  Aminoacyl-tRNA biosynthesis
pcj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CUJ87_00430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pcj03029]
    CUJ87_00430
Enzymes [BR:pcj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CUJ87_00430
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CUJ87_00430
Mitochondrial biogenesis [BR:pcj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CUJ87_00430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AXF13050
UniProt: A0A2Z5M713
LinkDB All DBs
Position
PHRS4_A:101339..102826
Genome map
AA seq 495 aa AA seqDB search
MHEKSLTELRAALAAKECSAVELAQLYLKRIDAANSLNAFIQVDADLTLAQAKAADALLH
AGHGGPLTGLPIAHKDVFVTKGWRSTAGSKMLSNYESPFDATVVERLQKAGMVCVGKTNM
DEFAMGSSNENSYFGPVQNPWDRQAVPGGSSGGSAAAVAARLAPAATGTDTGGSIRQPAS
FSGITGIKPTYGRVSRYGMIAFASSLDQGGPMAQSAADCATLLNAMAGFDERDSTSLVRD
DEDYTRYLGQPWKQDGAGKPLAGLRIGLPKEYFGAGLADDVRASIDAALKEYEALGATLV
EVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRFGHRAAEYRDLLDMYKKSRAEGFGPEV
KRRIMVGAYVLSHGYYDAYYLQAQKIRRIIAQDFQEAFKQCDVIMGPVAPSVAWDLGAKG
DDPVQMYLADVYTLSVSLAGLPGMSVPCGFGAGANAQRPVGLQIIGNYFNEARMLQVADA
FQRATDWHRKAPAGV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaaaaaagtctgaccgaactgcgcgccgcactggcggcgaaggaatgctccgcc
gtcgaactggcgcagctttatctcaagcgcatcgacgcggccaatagcctgaacgctttc
atccaggtcgacgccgacctgacgctcgcgcaggcaaaggcagcggacgcgctgcttcac
gcgggccacggcggtccgctgaccggcctgcccatcgcgcacaaagacgtgttcgtcacc
aagggctggcgctccactgccggttcgaaaatgttgtcgaactacgaaagcccgttcgac
gcaacggtggtcgagcgtctgcagaaggcgggtatggtttgcgtcggcaagaccaacatg
gacgaattcgcgatgggctcgtccaacgaaaattcgtactttggtcccgtgcaaaacccg
tgggatcgtcaggccgtaccgggcggctcgtcgggcggttccgcggcggcggtcgccgcg
cgcctcgcgcccgccgcgaccggcacagacaccggcggctcgatccgtcaaccggcgtcg
ttctcggggatcaccggcatcaagcctacgtacggccgcgtgtcgcgctacggcatgatc
gcgtttgcgtcgtcgttggatcagggaggtccgatggcgcaaagcgccgccgattgcgcc
acactgctcaacgccatggccggcttcgacgagcgcgattcgacgagcctcgtgcgcgac
gacgaagactacacgcgctatctcggccagccgtggaaacaggacggcgctggcaagccg
ctcgccggtctgcgcatcggcctgccgaaagagtatttcggcgcgggtctcgccgacgac
gtgcgcgcttctatcgacgccgcgttgaaggaatacgaagctctcggcgcaacgctcgtc
gaagtgtcgttgccgaaaaccgagctgtcgatcccggtctactacgtgatcgcgccggcg
gaggcgtcgtcgaacctgtcgcgtttcgacggcgtgcgctttggccatcgcgccgcggaa
tatcgcgacctgctcgacatgtacaagaagtcgcgggccgaaggtttcggtccggaagtg
aagcgccgcatcatggtcggcgcttacgtgttgtcgcacgggtattacgacgcgtactac
ctgcaggcacagaaaatccgccgcatcatcgcgcaggacttccaggaagcgttcaagcag
tgcgatgtgatcatgggaccggtcgcgccgtcggtggcgtgggatttgggtgcgaagggc
gacgacccggtgcagatgtatctcgccgacgtctacacgctgtcggtgagcctcgccggc
ttgcccggcatgagcgtgccgtgcggcttcggcgcgggcgcgaacgcgcagcgccccgtg
ggattgcagatcatcggcaactatttcaatgaagcccggatgctgcaggtggccgacgcg
ttccagcgcgcgaccgactggcaccgtaaagcaccggcaggagtgtga

DBGET integrated database retrieval system