KEGG   Paraburkholderia caledonica: CUJ87_13955Help
Entry
CUJ87_13955       CDS       T05740                                 

Definition
(GenBank) erythritol/L-threitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
pcj  Paraburkholderia caledonica
Brite
KEGG Orthology (KO) [BR:pcj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CUJ87_13955
Enzymes [BR:pcj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     CUJ87_13955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Spermine_synth
Motif
Other DBs
NCBI-ProteinID: AXF15368
UniProt: A0A2Z5MF82
LinkDB All DBs
Position
PHRS4_A:complement(3156542..3157639)
Genome map
AA seq 365 aa AA seqDB search
MTNQSTSSDKQNMTAIVCHAPKDYRVEQVAKPRAGAHELVIRIAACGICASDCKCHSGAK
MFWGGPSPWVKAPVIPGHEFFGFVQELGEGAAEHFGVKIGDRVIAEQIVPCGKCRYCKSG
QYWMCEVHNIFGFQREVADGGMAEYMRIPPTAIVHKIPDGISLEDAAIIEPLACAIHTVN
RGDVQLDDVVVIAGAGPLGLMMTQVAHLKTPKKLVVIDLVEERLALAREYGADVTINPKQ
DDALAIIHSLTDGYGCDVYIETTGAPVGVNQGMDLIRKLGRFVEFSVFGADTTLDWSVIG
DRKELDVRGAHLGPYCYPIAIDLLARGLVTSKGIVTHGFSLEEWDEAIKVADSLDSIKVL
MKPRA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcaatccacttcatccgacaagcagaacatgaccgcgattgtttgccacgca
ccgaaagactaccgcgtggaacaggtagcgaaaccgcgtgcgggagcgcacgaactggtg
attcgcatcgccgcatgcgggatctgcgcgagcgattgcaaatgccattcgggcgcgaag
atgttctggggcgggccaagcccgtgggtcaaggcgccagtgattccaggccacgagttc
ttcggcttcgtgcaggaactcggcgaaggcgcggcagaacatttcggcgtgaagatcggc
gaccgcgtgatcgccgagcagattgtgccttgcggcaagtgccgttattgcaaatccggc
cagtactggatgtgcgaagtgcacaacatcttcggctttcagcgcgaagtcgccgacggc
ggcatggccgagtacatgcgtattccgccgactgcaatcgtccacaagattcccgacggt
atttcactggaagacgccgctatcatcgagcccctcgcgtgcgcgattcacaccgtcaat
cgcggcgatgtgcagttggacgacgtcgtcgtgattgcaggcgcaggtccgctcggtttg
atgatgacgcaagtcgcgcatctgaaaacgccgaagaaactcgtcgtgatcgatctggtg
gaagagcgcctcgcactcgcgcgcgagtatggcgcggacgtgacgatcaacccgaaacag
gacgacgcgctcgcgatcatccattcgctcactgacggctacggctgcgacgtctatatt
gaaacgaccggcgcgccagtcggcgtcaatcagggcatggatctgatccgcaagctcggg
cgcttcgtcgagttctcggtgtttggcgcggatactacgctcgactggtcggtgatcggc
gatcgcaaggaactcgacgtgcgcggcgcgcatctcgggccgtattgctatccgattgcg
atcgatctgctcgcgcgcggactcgtgacgtcgaaaggcatcgtcacacacggcttttct
ctggaagaatgggacgaggcgattaaggtcgccgattcgctggattcgatcaaagtactc
atgaagccgcgcgcctga

DBGET integrated database retrieval system