KEGG   Paraburkholderia caledonica: CUJ87_30240Help
Entry
CUJ87_30240       CDS       T05740                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pcj  Paraburkholderia caledonica
Pathway
pcj00440  Phosphonate and phosphinate metabolism
pcj01100  Metabolic pathways
pcj01120  Microbial metabolism in diverse environments
pcj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pcj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    CUJ87_30240 (aepX)
Enzymes [BR:pcj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     CUJ87_30240 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AXF18413
UniProt: A0A2Z5MMC1
LinkDB All DBs
Position
PHRS4_B:2843748..2845472
Genome map
AA seq 574 aa AA seqDB search
MNAREPAFVSASRSARLRQMLVSNELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADMDEFCGKIKAGKDSQSDENFSIVARVEALIAGWGMDEALR
RAEAYRRAGADAILIHSKLSRPDEILEFAREWAGRGPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAREIHTSETLVNVEDRIAGVNEIFRLQDADEYSEAEDRYLSS
GRAASAAVVLAASRGKGLEAVTQDRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVGGYR
ADAIDTAGIKLVVNEKHAETGELASLACALDKLAGDTLISYGDLLFRSYILRDLVESEAA
FSVVVDSSVTDAENASVRDFAWCSAADDRGLFGNKVLLRHVSSGQQASSEIAAQTPHGRW
VGLLNVRGEGCERLRAVMQQLQARADFASLDMPALLNALIEAGESIEVQYVHGHWRGVND
LEDFRRAGDFAHGQTPLAASVGTQATDSANGAAQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgcccgcgaacccgccttcgtctccgcttcccgcagcgcacgtctgcgccagatg
cttgtcagcaacgaactcgaattcatgatggaggcccataacggcctgtccgcccgcatc
gtgcgcgaagcaggtttcaaggcgatctggggctcgggcctcgcgatttccgcgcaattc
ggcgtgcgcgacaacaacgaagcaagctggacgcaggtagtcgacaacctcgaattcatg
gccgacgcaagcgatctgcccattctgctcgacggcgataccggctacggcaacttcaac
aacgtgcgccgcctcgtgcgcaagctcgaacaacgcggcattgcaggcgtatgtatcgaa
gacaagcagttcccgaaaacgaatagcttcattaacggcgaagcgcagccgctcgccgat
atggacgaattctgcggcaagatcaaggccggtaaggactcgcagtcggacgagaatttt
tcgatcgtggcgcgtgtggaagcgctgatcgcaggctggggcatggacgaagcgctgcgc
cgcgcggaagcgtaccgccgcgccggcgccgacgcgatcctgattcacagcaagctctcg
cgtcccgacgaaattctcgagttcgcgcgtgagtgggcgggccgtgggccgctcgtcatc
gtgcccaccaagtactacagcacgccgaccgaagtgttccgcgaagctggcatcagcacg
gtgatctgggcgaaccatctgattcgcgcggcgacctcggcgatgcaggccgtcgcacga
gagatccatacgagcgaaacgctcgtcaatgtcgaagaccgcattgccggcgtcaacgaa
attttccgcttgcaggacgcggacgaatactcggaagcggaagaccgctatctgtcgagc
ggccgcgcggcgagcgccgctgtcgtgcttgcagcgagccgcggcaagggcctcgaagcg
gtcactcaggaccgtccgaaggtcatgctgccgatcgccggtaagccgctcttgcgctgg
ctggtcgacgcgttcaagaagcagggcgtcaacgacatcaccgtggtcggcggttatcgc
gccgatgcgatcgacacggccggtatcaagctcgtggtcaacgagaagcatgcggaaacc
ggcgaactcgcatcgcttgcgtgcgcgctcgacaagctcgcgggcgacacgctgatctcg
tacggcgatttgctgttccgcagctatatcctgcgcgatctggtggagagcgaggcggcg
ttcagcgtggtggtggattcgtcggtgaccgatgcggaaaacgcgagcgtgcgcgacttc
gcatggtgctcggcggccgacgaccgcggtctcttcggcaacaaggtgctgttgcgtcac
gtttcgagcgggcagcaggcgtcgtcggagattgccgcgcaaacgccgcatggccgctgg
gtcggtcttctgaacgtacgcggcgaaggctgcgagcgtcttcgggcagtcatgcagcag
ttgcaggcgcgtgccgatttcgcgtcgctcgacatgcccgctttgctgaacgcgctgatc
gaagccggtgaatcgatcgaggtgcaatacgtgcacggccactggcgcggtgtgaacgat
ctcgaagacttccgccgcgccggagacttcgcgcatggccagacgccgctcgccgcgtcg
gtcggcacgcaggcaacggattccgcgaacggagccgcgcaatga

DBGET integrated database retrieval system