KEGG   Pedobacter cryoconitis: AY601_0302Help
Entry
AY601_0302        CDS       T04341                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pcm  Pedobacter cryoconitis
Pathway
pcm00473  D-Alanine metabolism
pcm01100  Metabolic pathways
pcm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pcm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AY601_0302
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AY601_0302
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pcm01011]
    AY601_0302
Enzymes [BR:pcm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AY601_0302
Peptidoglycan biosynthesis and degradation proteins [BR:pcm01011]
 Precursor biosynthesis
  Racemase
   AY601_0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AMP97267
UniProt: A0A127V7P3
LinkDB All DBs
Position
337930..340389
Genome map
AA seq 819 aa AA seqDB search
MSEINYTIQQLAELLNIKSFELKYPALINSLLIDSRVVISPETSLFFALSAARDGHEFLA
EAYANGIKNFVVSKAGYQEKFPEANFLLVDDVHAALQLIAANHRNAFDLEVIAITGSNGK
TIVKEWLYQLLSSDFQVVRSPKSFNSQLGVPLSVWQIHQEHTLGIFEAGISKNGEMQQLA
EIIQPTIGILTNIGEAHAEGFTSPEEKLKEKLKLFKDVKLFIYSPDYTVNIPADELPGEQ
QFSWSTKTEADLSILFVEPINGKSYIKALYKGEEIECLLPFGDGASVENGIICWACLLAL
GYTPEQADIRLEHLTAVNMRLELKNGINQCSIIDDSYSADISSLAIALDFLNQQNQHPLK
TVILSDLPETGKTDVELYTEIAALLKQKQVNRLVGIGSHISAFASLFDLPAVFYENTEEF
IQKFAEITFNSETILVKGARRFEFERISKLLTQKVHGTVMEIDLNALASNLKFYKAKLAP
GVKVMAMVKAFSYGSGSFEIANLLQYHKVDYLAVAYTDEGIALRKAGITLPIMVMSPEPF
AFEAILKYKLEPELYNLDILKAFVAFLPETQTAYPVHIKIDTGMHRLGFEEPDLPALLPL
LNQTKKIKVVSAFSHLAASEDPQHDEFTGYQLETYLHLSGALRKGLGYGFIQHISNTSAI
TRHPEAQLDMVRIGIGLYGFDSGLADKSGLCTVAVLKTTITQIKTVGPKDTIGYGRWGVL
PDGGTTATIKIGYADGYRRSFGNGVGKMLVNGKFAPVIGTIAMDMCMLDVTGLDAKIGDE
VIIFNNELTVDDLAKQINTIPYEILTNISQRVKRIYFYE
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaataaactataccattcagcaattggctgaacttttaaatataaaatccttc
gaattaaaatatcccgctttaattaatagcctgcttatagacagccgtgtagtgatcagc
ccggaaacctctttgttctttgctttgtcagctgccagagacggacatgaatttcttgca
gaagcctatgccaatggcattaaaaactttgtcgttagtaaagctggatatcaggaaaaa
tttcctgaagctaactttcttttggtagatgatgtgcatgcggccttacaactcatcgct
gcaaatcaccgaaacgcatttgatctggaagtcatcgcaattacagggagtaacgggaaa
actatcgttaaagaatggctatatcaattactatcctcagatttccaggttgtcaggagc
ccgaaaagttttaactcacagcttggtgttcccctttctgtctggcaaattcatcaggaa
catacccttggaatctttgaagctggtatctctaaaaatggagaaatgcagcagctcgct
gaaattatacagcccactattggtatacttaccaatataggagaagcccatgccgaagga
tttacctctccggaagaaaagttgaaagagaaattgaaactcttcaaagatgttaaacta
tttatttacagtcctgattataccgtaaatatacctgcagatgaactaccaggtgaacaa
cagttttcctggagcacaaaaactgaagcagatttgtccattttgtttgtggaaccaatc
aatggtaaaagctatatcaaagcgctttacaaaggagaagaaattgaatgcctgcttcca
tttggcgacggggcatccgtagaaaacggaattatctgctgggcctgtttattagccctg
ggatataccccagagcaagcagatattcgtttagaacatttaacagctgtaaacatgcgt
ttagaactgaaaaatggtatcaatcaatgctccattattgacgattcctatagcgctgac
atttcttcgcttgctatagcccttgattttctgaatcagcaaaatcagcatccactgaaa
acagtgatcctgtcagacttgcccgaaacgggaaaaacggatgtggaactttatactgaa
attgccgctttgttaaaacaaaagcaggtaaacaggttggttggtataggatctcatatc
agtgcattcgcttccctctttgatttacctgcagtattctatgaaaatacagaagaattc
attcagaagtttgctgaaataacatttaacagtgaaacgatcctggttaaaggagcaagg
cgatttgaatttgaaaggatcagtaaactcctgacgcaaaaagttcatggaacagtcatg
gaaattgatttaaacgcattagccagtaatctgaaattctataaagcaaagttagcaccc
ggcgtgaaagtaatggccatggtaaaagccttctcttatggcagcggaagcttcgaaatt
gccaatttattacaatatcataaagtagattaccttgctgtagcttatacagacgaagga
attgctttaagaaaagcagggataactttaccaatcatggtgatgagtcctgaacctttt
gctttcgaggcgattttgaaatataagctggaacctgaactttataaccttgatattctg
aaagcatttgttgctttcttacctgaaacacaaacagcttatccagttcatattaaaatt
gataccgggatgcacagactgggatttgaagaaccagatcttccagcgttattgcccttg
ctcaaccagactaaaaagataaaagtagtttctgcattttcgcatcttgcagcaagtgaa
gacccgcagcatgatgaatttacaggctatcagctggaaacctatttgcatcttagcgga
gccctgcgcaaaggattaggttatggctttatacagcatatttccaatacctcggcaata
accagacatcccgaagcgcagctggacatggtcagaataggtataggtttatatggcttt
gacagtgggctggcagataaaagcggactctgtaccgtagctgttttaaaaactacgatc
acacaaattaagacagtaggccctaaggatactatcggttatgggcgctggggcgttttg
cccgatgggggcactacagcaactataaaaataggttacgcagatgggtaccgcagatcg
tttggaaacggggtagggaagatgctcgttaacggtaaatttgctcctgtaatcggtacc
attgccatggatatgtgtatgcttgatgtaaccggactggacgcgaaaattggggacgag
gttattattttcaataatgagctgacggttgatgatttagcgaagcaaattaatactatt
ccctatgagattttaacaaatatctctcaaagggtaaaacgcatctatttttatgagtag

DBGET integrated database retrieval system