KEGG   Pedobacter cryoconitis: AY601_0902Help
Entry
AY601_0902        CDS       T04341                                 

Definition
(GenBank) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
pcm  Pedobacter cryoconitis
Pathway
pcm00380  Tryptophan metabolism
pcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AY601_0902
Enzymes [BR:pcm01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AY601_0902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AMP97843
UniProt: A0A127V934
LinkDB All DBs
Position
1041582..1042871
Genome map
AA seq 429 aa AA seqDB search
MNFQNTLSFARTMDEQDPLRKFRDEFLFPQQNGKPFIYLCGNSLGLQPKSAREVLGKELD
NWQNLAVEGWFEGDSPWMFYHKELKKLMAPIVGATPAEVCPMNTLTVNLHLLLVSFYRPE
QKKFKIIMEAGAFPSDQYALESQVRFHGYDPAEAIIEIAPRAGEYTLRTADIIASIAENA
DELALVLFGGINYFTGQWFDMKAITEAGHAAGAIVGFDLAHAAGNVPVQLHEWDIDFACW
CSYKYQNSGPGGIGGIFVHEKHFKDDTLNRFAGWWGYQESTRFKMEKGFVPEPGADGWQI
SCSQVMPMALYYASLQIFEAAGFMGPIRDKSKILTAYLIYIIDQVNLAIGHQQYQVITPG
NENDRGTQVSIIASGNAKGVFEKLVAHHVLGDWREPNVIRLSPVPLYNSFEDVFLTGELL
LKISKEIAI
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaattttcaaaatacattatcatttgccaggacaatggatgaacaggatccgttgcgt
aaattccgcgatgaatttttatttccacagcaaaatggtaaaccttttatatatctgtgt
ggtaattcactgggtcttcaacccaaatcggcacgggaagtgcttggaaaagaattggac
aattggcagaatcttgcagtagagggctggtttgagggagacagtccatggatgttttac
cataaagaacttaaaaaactaatggcaccaattgttggcgcaacgcctgccgaagtttgt
ccaatgaacacgctgacagttaaccttcatttgttgctggttagcttttatcgcccggag
cagaaaaaatttaagatcattatggaggccggtgcttttccttctgatcagtacgcactg
gaaagtcaggtgcgttttcatgggtatgaccctgcagaagccattatagaaatcgctcca
agagctggtgaatacactttgcggacagcagatattattgccagtattgctgaaaatgca
gatgagctggccctggttttatttggtgggatcaactattttaccggtcaatggtttgat
atgaaggctatcactgaagctggtcatgctgctggtgcaattgtaggatttgatctggcg
catgcagccggaaatgtgccagtgcagttacatgaatgggatatagattttgcctgttgg
tgttcttataaataccaaaatagtggtccgggtggaataggaggcatatttgtccatgaa
aaacactttaaggatgataccttaaaccgctttgcaggttggtggggatatcaggaatct
acccgttttaagatggaaaagggatttgttcctgaacccggagcagatggctggcaaatt
agctgttcgcaggtgatgccaatggctttatattatgcttccctgcaaatttttgaagct
gcaggttttatgggaccaatcagggataaaagtaaaattttaacagcttacctgatttat
attatagaccaggtaaatttggcgattggccatcagcaatatcaggtgattacgcccgga
aatgaaaatgacaggggtacacaggtttctattattgcctctggaaatgcaaaaggtgtt
tttgaaaaattggttgcacatcatgtattgggggactggagagaaccgaatgtgattcga
ttaagccccgtacctttatataattcttttgaggatgttttcctgacaggtgaattgttg
ttgaaaataagtaaagagatagctatatga

DBGET integrated database retrieval system